Protein ID | Ophun1|3705 |
Gene name | |
Location | Contig_330:17528..18204 |
Strand | + |
Gene length (bp) | 676 |
Transcript length (bp) | 474 |
Coding sequence length (bp) | 474 |
Protein length (aa) | 158 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF16205 | Ribosomal_S17_N | Ribosomal_S17 N-terminal | 2.3E-28 | 11 | 72 |
PF00366 | Ribosomal_S17 | Ribosomal protein S17 | 1.9E-27 | 74 | 141 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P0CX48|RS11B_YEAST | 40S ribosomal protein S11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11B PE=1 SV=1 | 1 | 157 | 4.0E-76 |
sp|P0CX47|RS11A_YEAST | 40S ribosomal protein S11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11A PE=1 SV=1 | 1 | 157 | 4.0E-76 |
sp|P0CT74|RS11B_SCHPO | 40S ribosomal protein S11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1102 PE=3 SV=1 | 11 | 157 | 1.0E-75 |
sp|P0CT73|RS11A_SCHPO | 40S ribosomal protein S11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1101 PE=2 SV=1 | 11 | 157 | 1.0E-75 |
sp|P42756|RS11_DUNTE | 40S ribosomal protein S11 OS=Dunaliella tertiolecta GN=RPS11 PE=2 SV=1 | 28 | 157 | 9.0E-66 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P0CX48|RS11B_YEAST | 40S ribosomal protein S11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11B PE=1 SV=1 | 1 | 157 | 4.0E-76 |
sp|P0CX47|RS11A_YEAST | 40S ribosomal protein S11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11A PE=1 SV=1 | 1 | 157 | 4.0E-76 |
sp|P0CT74|RS11B_SCHPO | 40S ribosomal protein S11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1102 PE=3 SV=1 | 11 | 157 | 1.0E-75 |
sp|P0CT73|RS11A_SCHPO | 40S ribosomal protein S11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1101 PE=2 SV=1 | 11 | 157 | 1.0E-75 |
sp|P42756|RS11_DUNTE | 40S ribosomal protein S11 OS=Dunaliella tertiolecta GN=RPS11 PE=2 SV=1 | 28 | 157 | 9.0E-66 |
sp|O65569|RS112_ARATH | 40S ribosomal protein S11-2 OS=Arabidopsis thaliana GN=RPS11B PE=2 SV=2 | 10 | 153 | 5.0E-62 |
sp|P42733|RS113_ARATH | 40S ribosomal protein S11-3 OS=Arabidopsis thaliana GN=RPS11C PE=2 SV=2 | 10 | 145 | 3.0E-61 |
sp|P17093|RS11_SOYBN | 40S ribosomal protein S11 OS=Glycine max GN=RPS11 PE=2 SV=2 | 10 | 145 | 3.0E-61 |
sp|P16181|RS111_ARATH | 40S ribosomal protein S11-1 OS=Arabidopsis thaliana GN=RPS11A PE=2 SV=1 | 10 | 145 | 1.0E-60 |
sp|Q54S90|RS11_DICDI | 40S ribosomal protein S11 OS=Dictyostelium discoideum GN=rps11 PE=1 SV=1 | 1 | 142 | 3.0E-60 |
sp|Q9M5M1|RS11_EUPES | 40S ribosomal protein S11 OS=Euphorbia esula GN=RPS11 PE=2 SV=1 | 10 | 145 | 3.0E-60 |
sp|P62282|RS11_RAT | 40S ribosomal protein S11 OS=Rattus norvegicus GN=Rps11 PE=1 SV=3 | 11 | 157 | 2.0E-59 |
sp|P62281|RS11_MOUSE | 40S ribosomal protein S11 OS=Mus musculus GN=Rps11 PE=1 SV=3 | 11 | 157 | 2.0E-59 |
sp|P61270|RS11_MACFA | 40S ribosomal protein S11 OS=Macaca fascicularis GN=RPS11 PE=2 SV=3 | 11 | 157 | 2.0E-59 |
sp|P62280|RS11_HUMAN | 40S ribosomal protein S11 OS=Homo sapiens GN=RPS11 PE=1 SV=3 | 11 | 157 | 2.0E-59 |
sp|Q3T0V4|RS11_BOVIN | 40S ribosomal protein S11 OS=Bos taurus GN=RPS11 PE=2 SV=3 | 11 | 157 | 2.0E-59 |
sp|P25460|RS11_MAIZE | 40S ribosomal protein S11 OS=Zea mays GN=RPS11 PE=2 SV=1 | 10 | 145 | 6.0E-59 |
sp|Q9XSU4|RS11_CANLF | 40S ribosomal protein S11 OS=Canis lupus familiaris GN=RPS11 PE=1 SV=2 | 11 | 157 | 7.0E-59 |
sp|P41115|RS11_XENLA | 40S ribosomal protein S11 OS=Xenopus laevis GN=rps11 PE=2 SV=1 | 11 | 157 | 1.0E-58 |
sp|P52812|RS11_ANOGA | 40S ribosomal protein S11 OS=Anopheles gambiae GN=RpS11 PE=2 SV=2 | 30 | 157 | 1.0E-56 |
sp|Q292D0|RS11_DROPS | 40S ribosomal protein S11 OS=Drosophila pseudoobscura pseudoobscura GN=RpS11 PE=3 SV=2 | 34 | 154 | 1.0E-53 |
sp|Q6XHX5|RS11_DROYA | 40S ribosomal protein S11 OS=Drosophila yakuba GN=RpS11 PE=2 SV=1 | 34 | 154 | 2.0E-51 |
sp|Q0E9B6|RS11_DROME | 40S ribosomal protein S11 OS=Drosophila melanogaster GN=RpS11 PE=1 SV=1 | 34 | 154 | 2.0E-51 |
sp|Q0W1X9|RS17_METAR | 30S ribosomal protein S17P OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps17p PE=3 SV=1 | 37 | 143 | 6.0E-29 |
sp|Q8TW21|RS17_METKA | 30S ribosomal protein S17P OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps17p PE=3 SV=1 | 34 | 147 | 5.0E-28 |
sp|Q46GA4|RS17_METBF | 30S ribosomal protein S17P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps17p PE=3 SV=1 | 37 | 142 | 1.0E-26 |
sp|A3CT06|RS17_METMJ | 30S ribosomal protein S17P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps17p PE=3 SV=1 | 37 | 144 | 2.0E-26 |
sp|Q2FT32|RS17_METHJ | 30S ribosomal protein S17P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps17p PE=3 SV=1 | 37 | 143 | 6.0E-26 |
sp|A7I5P8|RS17_METB6 | 30S ribosomal protein S17P OS=Methanoregula boonei (strain 6A8) GN=rps17p PE=3 SV=1 | 37 | 143 | 1.0E-25 |
sp|A2SPL1|RS17_METLZ | 30S ribosomal protein S17P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps17p PE=3 SV=1 | 37 | 144 | 1.0E-25 |
sp|B8GKE2|RS17_METPE | 30S ribosomal protein S17P OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps17p PE=3 SV=1 | 37 | 143 | 5.0E-25 |
sp|Q8TRT8|RS17_METAC | 30S ribosomal protein S17P OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps17p PE=3 SV=1 | 37 | 142 | 5.0E-25 |
sp|Q8PV41|RS17_METMA | 30S ribosomal protein S17P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps17p PE=3 SV=2 | 37 | 142 | 7.0E-25 |
sp|O24786|RS17_HALSA | 30S ribosomal protein S17P OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps17p PE=3 SV=1 | 39 | 143 | 5.0E-24 |
sp|B0R665|RS17_HALS3 | 30S ribosomal protein S17P OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps17p PE=3 SV=1 | 39 | 143 | 5.0E-24 |
sp|P54036|RS17_METJA | 30S ribosomal protein S17P OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps17p PE=3 SV=1 | 37 | 150 | 6.0E-23 |
sp|Q12ZU2|RS17_METBU | 30S ribosomal protein S17P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps17p PE=3 SV=1 | 37 | 142 | 1.0E-22 |
sp|O26120|RS17_METTH | 30S ribosomal protein S17P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps17p PE=3 SV=1 | 39 | 143 | 2.0E-22 |
sp|P14042|RS17_METVA | 30S ribosomal protein S17P OS=Methanococcus vannielii GN=rps17p PE=3 SV=1 | 38 | 142 | 2.0E-22 |
sp|Q6LXE4|RS17_METMP | 30S ribosomal protein S17P OS=Methanococcus maripaludis (strain S2 / LL) GN=rps17p PE=3 SV=1 | 38 | 142 | 2.0E-22 |
sp|P12741|RS17_HALMA | 30S ribosomal protein S17P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps17p PE=1 SV=3 | 39 | 135 | 4.0E-22 |
sp|Q18GF8|RS17_HALWD | 30S ribosomal protein S17P OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps17p PE=3 SV=1 | 39 | 135 | 9.0E-22 |
sp|Q9V1U5|RS17_PYRAB | 30S ribosomal protein S17P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps17p PE=3 SV=2 | 37 | 147 | 1.0E-21 |
sp|O59426|RS17_PYRHO | 30S ribosomal protein S17P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps17p PE=3 SV=1 | 37 | 147 | 2.0E-21 |
sp|O28363|RS17_ARCFU | 30S ribosomal protein S17P OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps17p PE=3 SV=1 | 37 | 148 | 3.0E-21 |
sp|Q9UX98|RS17_SULSO | 30S ribosomal protein S17P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps17p PE=3 SV=1 | 56 | 141 | 3.0E-21 |
sp|Q8U008|RS17_PYRFU | 30S ribosomal protein S17P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps17p PE=1 SV=1 | 37 | 147 | 3.0E-20 |
sp|Q2NFW6|RS17_METST | 30S ribosomal protein S17P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps17p PE=3 SV=1 | 39 | 143 | 4.0E-20 |
sp|Q9HIR8|RS17_THEAC | 30S ribosomal protein S17P OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps17p PE=3 SV=1 | 35 | 142 | 9.0E-20 |
sp|Q97BW7|RS17_THEVO | 30S ribosomal protein S17P OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps17p PE=3 SV=1 | 37 | 142 | 1.0E-19 |
sp|Q6L1B8|RS17_PICTO | 30S ribosomal protein S17P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps17p PE=3 SV=1 | 37 | 141 | 4.0E-19 |
sp|Q975I9|RS17_SULTO | 30S ribosomal protein S17P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps17p PE=3 SV=2 | 29 | 141 | 5.0E-19 |
sp|Q9YF81|RS17_AERPE | 30S ribosomal protein S17P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps17p PE=3 SV=2 | 56 | 143 | 7.0E-19 |
sp|Q4JB49|RS17_SULAC | 30S ribosomal protein S17P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps17p PE=3 SV=1 | 29 | 143 | 1.0E-18 |
sp|Q5JDH9|RS17_THEKO | 30S ribosomal protein S17P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps17p PE=3 SV=1 | 37 | 150 | 2.0E-18 |
sp|A9A5I6|RS17_NITMS | 30S ribosomal protein S17P OS=Nitrosopumilus maritimus (strain SCM1) GN=rps17p PE=3 SV=1 | 37 | 143 | 1.0E-17 |
sp|Q8TP90|RS17L_METAC | Putative 30S ribosomal protein S17P-like OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2024 PE=3 SV=1 | 37 | 141 | 1.0E-13 |
sp|Q74NJ4|RS17_NANEQ | 30S ribosomal protein S17P OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps17p PE=3 SV=1 | 56 | 141 | 4.0E-13 |
sp|Q8ZWL3|RS17_PYRAE | 30S ribosomal protein S17P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps17p PE=3 SV=2 | 37 | 141 | 2.0E-11 |
sp|C5CGQ5|RS17_KOSOT | 30S ribosomal protein S17 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsQ PE=3 SV=1 | 72 | 147 | 2.0E-09 |
sp|C0Q9W4|RS17_DESAH | 30S ribosomal protein S17 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsQ PE=3 SV=1 | 68 | 146 | 3.0E-09 |
sp|P38519|RS17_THEMA | 30S ribosomal protein S17 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsQ PE=3 SV=2 | 72 | 146 | 5.0E-09 |
sp|Q089P5|RS17_SHEFN | 30S ribosomal protein S17 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsQ PE=3 SV=1 | 65 | 146 | 6.0E-09 |
sp|A5IM92|RS17_THEP1 | 30S ribosomal protein S17 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsQ PE=3 SV=1 | 72 | 146 | 6.0E-09 |
sp|A5D5G4|RS17_PELTS | 30S ribosomal protein S17 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsQ PE=3 SV=1 | 72 | 147 | 1.0E-08 |
sp|Q12SV0|RS17_SHEDO | 30S ribosomal protein S17 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsQ PE=3 SV=1 | 65 | 146 | 1.0E-08 |
sp|P24321|RS17_THETH | 30S ribosomal protein S17 OS=Thermus thermophilus GN=rpsQ PE=1 SV=4 | 70 | 144 | 2.0E-08 |
sp|P62658|RS17_THET2 | 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsQ PE=1 SV=2 | 70 | 144 | 2.0E-08 |
sp|Q1R0G6|RS17_CHRSD | 30S ribosomal protein S17 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsQ PE=3 SV=1 | 69 | 146 | 2.0E-08 |
sp|B8DNA5|RS17_DESVM | 30S ribosomal protein S17 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsQ PE=3 SV=1 | 64 | 147 | 2.0E-08 |
sp|Q5SHP7|RS17_THET8 | 30S ribosomal protein S17 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsQ PE=1 SV=3 | 70 | 144 | 2.0E-08 |
sp|P0CE05|RS17_CHLTR | 30S ribosomal protein S17 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsQ PE=3 SV=1 | 66 | 141 | 2.0E-08 |
sp|B0BCF8|RS17_CHLTB | 30S ribosomal protein S17 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsQ PE=3 SV=1 | 66 | 141 | 2.0E-08 |
sp|Q3KLH8|RS17_CHLTA | 30S ribosomal protein S17 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsQ PE=3 SV=1 | 66 | 141 | 2.0E-08 |
sp|B0B893|RS17_CHLT2 | 30S ribosomal protein S17 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsQ PE=3 SV=1 | 66 | 141 | 2.0E-08 |
sp|Q9PJM3|RS17_CHLMU | 30S ribosomal protein S17 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsQ PE=3 SV=1 | 66 | 141 | 2.0E-08 |
sp|B6IRR5|RS17_RHOCS | 30S ribosomal protein S17 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsQ PE=3 SV=1 | 70 | 141 | 2.0E-08 |
sp|A0T0Y2|RR17_THAPS | 30S ribosomal protein S17, chloroplastic OS=Thalassiosira pseudonana GN=rps17 PE=3 SV=1 | 74 | 148 | 2.0E-08 |
sp|A5USI0|RS17_ROSS1 | 30S ribosomal protein S17 OS=Roseiflexus sp. (strain RS-1) GN=rpsQ PE=3 SV=1 | 74 | 147 | 4.0E-08 |
sp|Q6LVA7|RS17_PHOPR | 30S ribosomal protein S17 OS=Photobacterium profundum GN=rpsQ PE=3 SV=1 | 65 | 146 | 4.0E-08 |
sp|C6C194|RS17_DESAD | 30S ribosomal protein S17 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsQ PE=3 SV=1 | 70 | 147 | 4.0E-08 |
sp|Q0I096|RS17_SHESR | 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-7) GN=rpsQ PE=3 SV=1 | 65 | 146 | 5.0E-08 |
sp|Q0HNS8|RS17_SHESM | 30S ribosomal protein S17 OS=Shewanella sp. (strain MR-4) GN=rpsQ PE=3 SV=1 | 65 | 146 | 5.0E-08 |
sp|A0KRN3|RS17_SHESA | 30S ribosomal protein S17 OS=Shewanella sp. (strain ANA-3) GN=rpsQ PE=3 SV=1 | 65 | 146 | 5.0E-08 |
sp|Q8EK60|RS17_SHEON | 30S ribosomal protein S17 OS=Shewanella oneidensis (strain MR-1) GN=rpsQ PE=3 SV=1 | 65 | 146 | 5.0E-08 |
sp|B3E7U4|RS17_GEOLS | 30S ribosomal protein S17 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-08 |
sp|Q5L711|RS17_CHLAB | 30S ribosomal protein S17 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsQ PE=3 SV=1 | 74 | 141 | 7.0E-08 |
sp|B1LBN1|RS17_THESQ | 30S ribosomal protein S17 OS=Thermotoga sp. (strain RQ2) GN=rpsQ PE=3 SV=1 | 72 | 146 | 8.0E-08 |
sp|A7NR54|RS17_ROSCS | 30S ribosomal protein S17 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpsQ PE=3 SV=1 | 74 | 147 | 9.0E-08 |
sp|Q824P2|RS17_CHLCV | 30S ribosomal protein S17 OS=Chlamydophila caviae (strain GPIC) GN=rpsQ PE=3 SV=1 | 74 | 141 | 9.0E-08 |
sp|A7HM43|RS17_FERNB | 30S ribosomal protein S17 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsQ PE=3 SV=1 | 72 | 147 | 9.0E-08 |
sp|A0T0I8|RR17_PHATC | 30S ribosomal protein S17, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps17 PE=3 SV=1 | 74 | 148 | 1.0E-07 |
sp|Q88QM6|RS17_PSEPK | 30S ribosomal protein S17 OS=Pseudomonas putida (strain KT2440) GN=rpsQ PE=3 SV=1 | 70 | 146 | 1.0E-07 |
sp|A5VXQ6|RS17_PSEP1 | 30S ribosomal protein S17 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsQ PE=3 SV=1 | 70 | 146 | 1.0E-07 |
sp|P73311|RS17_SYNY3 | 30S ribosomal protein S17 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsQ PE=3 SV=1 | 65 | 148 | 1.0E-07 |
sp|Q9Z7R6|RS17_CHLPN | 30S ribosomal protein S17 OS=Chlamydia pneumoniae GN=rpsQ PE=3 SV=1 | 70 | 141 | 1.0E-07 |
sp|A1S227|RS17_SHEAM | 30S ribosomal protein S17 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsQ PE=3 SV=1 | 65 | 146 | 2.0E-07 |
sp|A1WVB3|RS17_HALHL | 30S ribosomal protein S17 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsQ PE=3 SV=1 | 70 | 148 | 2.0E-07 |
sp|P49504|RR17_ODOSI | 30S ribosomal protein S17, chloroplastic OS=Odontella sinensis GN=rps17 PE=3 SV=1 | 74 | 148 | 2.0E-07 |
sp|B7IHV5|RS17_THEAB | 30S ribosomal protein S17 OS=Thermosipho africanus (strain TCF52B) GN=rpsQ PE=3 SV=1 | 72 | 147 | 2.0E-07 |
sp|A8F4S0|RS17_PSELT | 30S ribosomal protein S17 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsQ PE=3 SV=1 | 72 | 146 | 2.0E-07 |
sp|Q30Z51|RS17_DESAG | 30S ribosomal protein S17 OS=Desulfovibrio alaskensis (strain G20) GN=rpsQ PE=3 SV=1 | 69 | 147 | 2.0E-07 |
sp|B8GV49|RS17_THISH | 30S ribosomal protein S17 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsQ PE=3 SV=1 | 70 | 148 | 2.0E-07 |
sp|A1TYK6|RS17_MARHV | 30S ribosomal protein S17 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsQ PE=3 SV=1 | 69 | 149 | 2.0E-07 |
sp|Q1RHN0|RS17_RICBR | 30S ribosomal protein S17 OS=Rickettsia bellii (strain RML369-C) GN=rpsQ PE=3 SV=1 | 70 | 141 | 3.0E-07 |
sp|A8GVC3|RS17_RICB8 | 30S ribosomal protein S17 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsQ PE=3 SV=1 | 70 | 141 | 3.0E-07 |
sp|Q252W2|RS17_CHLFF | 30S ribosomal protein S17 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsQ PE=3 SV=1 | 74 | 141 | 3.0E-07 |
sp|A9NAX9|RS17_COXBR | 30S ribosomal protein S17 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsQ PE=3 SV=1 | 70 | 149 | 3.0E-07 |
sp|B5YG38|RS17_THEYD | 30S ribosomal protein S17 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsQ PE=3 SV=1 | 70 | 144 | 3.0E-07 |
sp|A8EZK7|RS17_RICCK | 30S ribosomal protein S17 OS=Rickettsia canadensis (strain McKiel) GN=rpsQ PE=3 SV=1 | 70 | 135 | 3.0E-07 |
sp|B1JDX5|RS17_PSEPW | 30S ribosomal protein S17 OS=Pseudomonas putida (strain W619) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-07 |
sp|B0KK76|RS17_PSEPG | 30S ribosomal protein S17 OS=Pseudomonas putida (strain GB-1) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-07 |
sp|Q1IFV7|RS17_PSEE4 | 30S ribosomal protein S17 OS=Pseudomonas entomophila (strain L48) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-07 |
sp|A1REC3|RS17_SHESW | 30S ribosomal protein S17 OS=Shewanella sp. (strain W3-18-1) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|A4YBX4|RS17_SHEPC | 30S ribosomal protein S17 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|A9KWB1|RS17_SHEB9 | 30S ribosomal protein S17 OS=Shewanella baltica (strain OS195) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|A6WHT7|RS17_SHEB8 | 30S ribosomal protein S17 OS=Shewanella baltica (strain OS185) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|A3DA63|RS17_SHEB5 | 30S ribosomal protein S17 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|B8EBJ6|RS17_SHEB2 | 30S ribosomal protein S17 OS=Shewanella baltica (strain OS223) GN=rpsQ PE=3 SV=1 | 65 | 146 | 3.0E-07 |
sp|C3K2W7|RS17_PSEFS | 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsQ PE=3 SV=1 | 70 | 146 | 4.0E-07 |
sp|Q2JIL8|RS17_SYNJB | 30S ribosomal protein S17 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsQ PE=3 SV=1 | 65 | 144 | 4.0E-07 |
sp|B6EPT4|RS17_ALISL | 30S ribosomal protein S17 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsQ PE=3 SV=1 | 70 | 146 | 4.0E-07 |
sp|A1VEA7|RS17_DESVV | 30S ribosomal protein S17 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsQ PE=3 SV=1 | 68 | 147 | 4.0E-07 |
sp|Q72CH1|RS17_DESVH | 30S ribosomal protein S17 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsQ PE=3 SV=1 | 68 | 147 | 4.0E-07 |
sp|Q21M49|RS17_SACD2 | 30S ribosomal protein S17 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsQ PE=3 SV=1 | 70 | 146 | 4.0E-07 |
sp|A1ALV0|RS17_PELPD | 30S ribosomal protein S17 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsQ PE=3 SV=1 | 65 | 143 | 5.0E-07 |
sp|C5BQ70|RS17_TERTT | 30S ribosomal protein S17 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsQ PE=3 SV=1 | 70 | 146 | 5.0E-07 |
sp|O24698|RS17_SYNP6 | 30S ribosomal protein S17 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsQ PE=3 SV=1 | 74 | 148 | 5.0E-07 |
sp|Q31L16|RS17_SYNE7 | 30S ribosomal protein S17 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsQ PE=3 SV=1 | 74 | 148 | 5.0E-07 |
sp|A9KD22|RS17_COXBN | 30S ribosomal protein S17 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsQ PE=3 SV=1 | 70 | 149 | 6.0E-07 |
sp|Q2LQB1|RS17_SYNAS | 30S ribosomal protein S17 OS=Syntrophus aciditrophicus (strain SB) GN=rpsQ PE=3 SV=1 | 69 | 147 | 7.0E-07 |
sp|Q3K5Z7|RS17_PSEPF | 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-07 |
sp|Q4K542|RS17_PSEF5 | 30S ribosomal protein S17 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-07 |
sp|Q83ER7|RS17_COXBU | 30S ribosomal protein S17 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsQ PE=3 SV=1 | 70 | 149 | 7.0E-07 |
sp|A8ZV66|RS17_DESOH | 30S ribosomal protein S17 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-07 |
sp|Q748Z7|RS17_GEOSL | 30S ribosomal protein S17 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsQ PE=3 SV=1 | 74 | 146 | 7.0E-07 |
sp|Q0ABG6|RS17_ALKEH | 30S ribosomal protein S17 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsQ PE=3 SV=1 | 70 | 149 | 8.0E-07 |
sp|C4K2H0|RS17_RICPU | 30S ribosomal protein S17 OS=Rickettsia peacockii (strain Rustic) GN=rpsQ PE=3 SV=1 | 70 | 135 | 8.0E-07 |
sp|Q92GX5|RS17_RICCN | 30S ribosomal protein S17 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsQ PE=3 SV=2 | 70 | 135 | 8.0E-07 |
sp|C3PP98|RS17_RICAE | 30S ribosomal protein S17 OS=Rickettsia africae (strain ESF-5) GN=rpsQ PE=3 SV=1 | 70 | 135 | 8.0E-07 |
sp|Q4UMS0|RS17_RICFE | 30S ribosomal protein S17 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsQ PE=3 SV=1 | 70 | 135 | 9.0E-07 |
sp|A8GPE1|RS17_RICAH | 30S ribosomal protein S17 OS=Rickettsia akari (strain Hartford) GN=rpsQ PE=3 SV=1 | 70 | 135 | 9.0E-07 |
sp|A6TEW3|RS17_KLEP7 | 30S ribosomal protein S17 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsQ PE=3 SV=1 | 70 | 146 | 1.0E-06 |
sp|B7VLE8|RS17_VIBTL | 30S ribosomal protein S17 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsQ PE=3 SV=1 | 69 | 146 | 1.0E-06 |
sp|A8GT60|RS17_RICRS | 30S ribosomal protein S17 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsQ PE=3 SV=1 | 70 | 135 | 1.0E-06 |
sp|A6U868|RS17_SINMW | 30S ribosomal protein S17 OS=Sinorhizobium medicae (strain WSM419) GN=rpsQ PE=3 SV=1 | 70 | 141 | 1.0E-06 |
sp|B0BUQ1|RS17_RICRO | 30S ribosomal protein S17 OS=Rickettsia rickettsii (strain Iowa) GN=rpsQ PE=3 SV=1 | 70 | 135 | 1.0E-06 |
sp|B2JI57|RS17_BURP8 | 30S ribosomal protein S17 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsQ PE=3 SV=1 | 70 | 144 | 1.0E-06 |
sp|Q50309|RS17_MYCPN | 30S ribosomal protein S17 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsQ PE=3 SV=1 | 70 | 147 | 1.0E-06 |
sp|Q1MPQ5|RS17_LAWIP | 30S ribosomal protein S17 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsQ PE=3 SV=1 | 69 | 147 | 1.0E-06 |
sp|Q493J9|RS17_BLOPB | 30S ribosomal protein S17 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsQ PE=3 SV=1 | 65 | 135 | 2.0E-06 |
sp|Q1LTC9|RS17_BAUCH | 30S ribosomal protein S17 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsQ PE=3 SV=1 | 70 | 147 | 2.0E-06 |
sp|Q3A6N8|RS17_PELCD | 30S ribosomal protein S17 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsQ PE=3 SV=1 | 73 | 147 | 2.0E-06 |
sp|Q5E8A6|RS17_VIBF1 | 30S ribosomal protein S17 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q2JV90|RS17_SYNJA | 30S ribosomal protein S17 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsQ PE=3 SV=1 | 74 | 144 | 2.0E-06 |
sp|B2UEL0|RS17_RALPJ | 30S ribosomal protein S17 OS=Ralstonia pickettii (strain 12J) GN=rpsQ PE=3 SV=1 | 70 | 144 | 2.0E-06 |
sp|B5ELY8|RS17_ACIF5 | 30S ribosomal protein S17 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsQ PE=3 SV=1 | 70 | 144 | 2.0E-06 |
sp|B7J476|RS17_ACIF2 | 30S ribosomal protein S17 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsQ PE=3 SV=1 | 70 | 144 | 2.0E-06 |
sp|Q4ZMQ3|RS17_PSEU2 | 30S ribosomal protein S17 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q889W2|RS17_PSESM | 30S ribosomal protein S17 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q48D45|RS17_PSE14 | 30S ribosomal protein S17 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|A7N0I6|RS17_VIBCB | 30S ribosomal protein S17 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q9ZCR4|RS17_RICPR | 30S ribosomal protein S17 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsQ PE=3 SV=1 | 70 | 143 | 2.0E-06 |
sp|A0LIJ9|RS17_SYNFM | 30S ribosomal protein S17 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsQ PE=3 SV=1 | 73 | 147 | 2.0E-06 |
sp|B9K895|RS17_THENN | 30S ribosomal protein S17 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsQ PE=3 SV=1 | 72 | 146 | 2.0E-06 |
sp|Q39XZ7|RS17_GEOMG | 30S ribosomal protein S17 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsQ PE=3 SV=1 | 74 | 146 | 2.0E-06 |
sp|Q9HWE4|RS17_PSEAE | 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q02T71|RS17_PSEAB | 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|B7V653|RS17_PSEA8 | 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|A6UZJ7|RS17_PSEA7 | 30S ribosomal protein S17 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q68W87|RS17_RICTY | 30S ribosomal protein S17 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsQ PE=3 SV=1 | 70 | 143 | 2.0E-06 |
sp|B0TM03|RS17_SHEHH | 30S ribosomal protein S17 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsQ PE=3 SV=1 | 70 | 146 | 2.0E-06 |
sp|Q6MSN4|RS17_MYCMS | 30S ribosomal protein S17 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-06 |
sp|P10131|RS17_MYCCT | 30S ribosomal protein S17 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-06 |
sp|B8CNE2|RS17_SHEPW | 30S ribosomal protein S17 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-06 |
sp|A4WFB9|RS17_ENT38 | 30S ribosomal protein S17 OS=Enterobacter sp. (strain 638) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-06 |
sp|Q92QG1|RS17_RHIME | 30S ribosomal protein S17 OS=Rhizobium meliloti (strain 1021) GN=rpsQ PE=3 SV=1 | 70 | 141 | 3.0E-06 |
sp|B1KMX4|RS17_SHEWM | 30S ribosomal protein S17 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsQ PE=3 SV=1 | 70 | 146 | 3.0E-06 |
sp|Q5QXX3|RS17_IDILO | 30S ribosomal protein S17 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsQ PE=3 SV=1 | 68 | 146 | 3.0E-06 |
sp|A3Q991|RS17_SHELP | 30S ribosomal protein S17 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsQ PE=3 SV=1 | 70 | 146 | 4.0E-06 |
sp|A8AQK7|RS17_CITK8 | 30S ribosomal protein S17 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsQ PE=3 SV=1 | 70 | 146 | 4.0E-06 |
sp|Q2YAY8|RS17_NITMU | 30S ribosomal protein S17 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsQ PE=3 SV=1 | 69 | 146 | 4.0E-06 |
sp|B5EFQ9|RS17_GEOBB | 30S ribosomal protein S17 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsQ PE=3 SV=1 | 74 | 148 | 4.0E-06 |
sp|Q2SU36|RS17_BURTA | 30S ribosomal protein S17 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsQ PE=3 SV=1 | 70 | 144 | 4.0E-06 |
sp|Q13TH9|RS17_BURXL | 30S ribosomal protein S17 OS=Burkholderia xenovorans (strain LB400) GN=rpsQ PE=3 SV=1 | 70 | 144 | 4.0E-06 |
sp|B2T742|RS17_BURPP | 30S ribosomal protein S17 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsQ PE=3 SV=1 | 70 | 144 | 4.0E-06 |
sp|B1I1J7|RS17_DESAP | 30S ribosomal protein S17 OS=Desulforudis audaxviator (strain MP104C) GN=rpsQ PE=3 SV=1 | 70 | 147 | 4.0E-06 |
sp|B0JHZ4|RS17_MICAN | 30S ribosomal protein S17 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsQ PE=3 SV=1 | 74 | 144 | 5.0E-06 |
sp|A8GYY5|RS17_SHEPA | 30S ribosomal protein S17 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsQ PE=3 SV=1 | 70 | 146 | 5.0E-06 |
sp|A4JAP9|RS17_BURVG | 30S ribosomal protein S17 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsQ PE=3 SV=1 | 70 | 144 | 5.0E-06 |
sp|Q0BJ37|RS17_BURCM | 30S ribosomal protein S17 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsQ PE=3 SV=1 | 70 | 144 | 5.0E-06 |
sp|B1YRN8|RS17_BURA4 | 30S ribosomal protein S17 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsQ PE=3 SV=1 | 70 | 144 | 5.0E-06 |
sp|B0RU73|RS17_XANCB | 30S ribosomal protein S17 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsQ PE=3 SV=1 | 70 | 148 | 5.0E-06 |
sp|Q15YN0|RS17_PSEA6 | 30S ribosomal protein S17 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsQ PE=3 SV=1 | 69 | 146 | 6.0E-06 |
sp|Q2NQN1|RS17_SODGM | 30S ribosomal protein S17 OS=Sodalis glossinidius (strain morsitans) GN=rpsQ PE=3 SV=1 | 65 | 146 | 6.0E-06 |
sp|Q2S921|RS17_HAHCH | 30S ribosomal protein S17 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsQ PE=3 SV=1 | 70 | 149 | 6.0E-06 |
sp|Q1LI46|RS17_CUPMC | 30S ribosomal protein S17 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|Q63Q20|RS17_BURPS | 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain K96243) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|A3NEH0|RS17_BURP6 | 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 668) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|Q3JMS2|RS17_BURP1 | 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|A3P0A4|RS17_BURP0 | 30S ribosomal protein S17 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|A1V894|RS17_BURMS | 30S ribosomal protein S17 OS=Burkholderia mallei (strain SAVP1) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|Q62GL4|RS17_BURMA | 30S ribosomal protein S17 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|A2S7I5|RS17_BURM9 | 30S ribosomal protein S17 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|A3MRW3|RS17_BURM7 | 30S ribosomal protein S17 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsQ PE=3 SV=1 | 70 | 144 | 6.0E-06 |
sp|Q3A9S5|RS17_CARHZ | 30S ribosomal protein S17 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsQ PE=3 SV=1 | 70 | 146 | 6.0E-06 |
sp|A9IIY6|RS17_BORPD | 30S ribosomal protein S17 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsQ PE=3 SV=1 | 68 | 144 | 7.0E-06 |
sp|A9ADK2|RS17_BURM1 | 30S ribosomal protein S17 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|Q39KF8|RS17_BURL3 | 30S ribosomal protein S17 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|B4E5C9|RS17_BURCJ | 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|A0K3N4|RS17_BURCH | 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|B1JU31|RS17_BURCC | 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|Q1BRV7|RS17_BURCA | 30S ribosomal protein S17 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsQ PE=3 SV=1 | 70 | 144 | 7.0E-06 |
sp|Q8PC41|RS17_XANCP | 30S ribosomal protein S17 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsQ PE=3 SV=1 | 70 | 148 | 7.0E-06 |
sp|Q4URE8|RS17_XANC8 | 30S ribosomal protein S17 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsQ PE=3 SV=1 | 70 | 148 | 7.0E-06 |
sp|Q3YWU8|RS17_SHISS | 30S ribosomal protein S17 OS=Shigella sonnei (strain Ss046) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|P0AG66|RS17_SHIFL | 30S ribosomal protein S17 OS=Shigella flexneri GN=rpsQ PE=3 SV=2 | 70 | 146 | 7.0E-06 |
sp|Q0SZZ1|RS17_SHIF8 | 30S ribosomal protein S17 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|Q32B40|RS17_SHIDS | 30S ribosomal protein S17 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|Q31VW5|RS17_SHIBS | 30S ribosomal protein S17 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B2U2S9|RS17_SHIB3 | 30S ribosomal protein S17 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7LRS7|RS17_ESCF3 | 30S ribosomal protein S17 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|Q1R616|RS17_ECOUT | 30S ribosomal protein S17 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B1LHC5|RS17_ECOSM | 30S ribosomal protein S17 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B6I225|RS17_ECOSE | 30S ribosomal protein S17 OS=Escherichia coli (strain SE11) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7NDT2|RS17_ECOLU | 30S ribosomal protein S17 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|P0AG63|RS17_ECOLI | 30S ribosomal protein S17 OS=Escherichia coli (strain K12) GN=rpsQ PE=1 SV=2 | 70 | 146 | 7.0E-06 |
sp|B1IPY8|RS17_ECOLC | 30S ribosomal protein S17 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|P0AG64|RS17_ECOL6 | 30S ribosomal protein S17 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsQ PE=3 SV=2 | 70 | 146 | 7.0E-06 |
sp|Q0TCF0|RS17_ECOL5 | 30S ribosomal protein S17 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|A1AGK0|RS17_ECOK1 | 30S ribosomal protein S17 OS=Escherichia coli O1:K1 / APEC GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|A8A5B6|RS17_ECOHS | 30S ribosomal protein S17 OS=Escherichia coli O9:H4 (strain HS) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B1X6G3|RS17_ECODH | 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / DH10B) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|C4ZUG6|RS17_ECOBW | 30S ribosomal protein S17 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7M1M5|RS17_ECO8A | 30S ribosomal protein S17 OS=Escherichia coli O8 (strain IAI1) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7N0V1|RS17_ECO81 | 30S ribosomal protein S17 OS=Escherichia coli O81 (strain ED1a) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7NLN0|RS17_ECO7I | 30S ribosomal protein S17 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B5YTN2|RS17_ECO5E | 30S ribosomal protein S17 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|P0AG65|RS17_ECO57 | 30S ribosomal protein S17 OS=Escherichia coli O157:H7 GN=rpsQ PE=3 SV=2 | 70 | 146 | 7.0E-06 |
sp|B7L4K0|RS17_ECO55 | 30S ribosomal protein S17 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7MCS6|RS17_ECO45 | 30S ribosomal protein S17 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|B7UK35|RS17_ECO27 | 30S ribosomal protein S17 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|A7ZSK0|RS17_ECO24 | 30S ribosomal protein S17 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|A7MPH2|RS17_CROS8 | 30S ribosomal protein S17 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsQ PE=3 SV=1 | 70 | 146 | 7.0E-06 |
sp|A4XLS1|RS17_CALS8 | 30S ribosomal protein S17 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsQ PE=3 SV=1 | 74 | 146 | 7.0E-06 |
sp|Q46WF3|RS17_CUPPJ | 30S ribosomal protein S17 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsQ PE=3 SV=1 | 70 | 144 | 8.0E-06 |
sp|B3R7R4|RS17_CUPTR | 30S ribosomal protein S17 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsQ PE=3 SV=1 | 70 | 144 | 9.0E-06 |
sp|Q0K628|RS17_CUPNH | 30S ribosomal protein S17 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsQ PE=3 SV=1 | 70 | 144 | 9.0E-06 |
sp|B8ELF4|RS17_METSB | 30S ribosomal protein S17 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsQ PE=3 SV=1 | 70 | 141 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003735 | structural constituent of ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0005840 | ribosome | Yes |
GO:0043043 | peptide biosynthetic process | No |
GO:0043226 | organelle | No |
GO:0043229 | intracellular organelle | No |
GO:0043170 | macromolecule metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0019538 | protein metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0005198 | structural molecule activity | No |
GO:0044238 | primary metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0110165 | cellular anatomical entity | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0005575 | cellular_component | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0043603 | cellular amide metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 28 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|3705 MSVIAALSTLKQPHIFQNAKVKTKSSRPGKNGRRWYKDVGLGFRTPKTAIEGSYIDKKCPFTGLVSIRGRILTGT VVSTKMHRTVIVRREYLHFIPKYSRYEKRHKNLAAHVSPAFRVEEGDQVTVGQCRPLSKTVRFNVLRVLPRTGKT VKKFSKF* |
Coding | >Ophun1|3705 ATGTCAGTAATCGCAGCGCTCTCGACTCTCAAGCAGCCGCACATCTTCCAAAACGCCAAGGTCAAGACCAAGAGC AGCAGGCCCGGCAAGAACGGACGTCGGTGGTATAAGGATGTTGGTCTGGGCTTCCGGACGCCCAAGACGGCGATC GAGGGCAGCTATATCGATAAGAAGTGCCCGTTTACCGGCCTCGTCTCGATTCGCGGCCGTATTCTGACCGGCACC GTCGTCTCCACGAAGATGCACCGAACCGTCATCGTCCGAAGAGAGTACCTGCACTTCATTCCCAAGTACTCTCGC TACGAGAAGCGCCACAAGAACCTCGCCGCACATGTTTCTCCTGCCTTCCGTGTCGAGGAGGGCGACCAGGTCACC GTTGGCCAGTGCAGGCCCCTCAGCAAGACGGTTCGTTTCAACGTACTGCGCGTGCTGCCCCGGACCGGCAAGACG GTCAAGAAGTTTAGCAAGTTTTAG |
Transcript | >Ophun1|3705 ATGTCAGTAATCGCAGCGCTCTCGACTCTCAAGCAGCCGCACATCTTCCAAAACGCCAAGGTCAAGACCAAGAGC AGCAGGCCCGGCAAGAACGGACGTCGGTGGTATAAGGATGTTGGTCTGGGCTTCCGGACGCCCAAGACGGCGATC GAGGGCAGCTATATCGATAAGAAGTGCCCGTTTACCGGCCTCGTCTCGATTCGCGGCCGTATTCTGACCGGCACC GTCGTCTCCACGAAGATGCACCGAACCGTCATCGTCCGAAGAGAGTACCTGCACTTCATTCCCAAGTACTCTCGC TACGAGAAGCGCCACAAGAACCTCGCCGCACATGTTTCTCCTGCCTTCCGTGTCGAGGAGGGCGACCAGGTCACC GTTGGCCAGTGCAGGCCCCTCAGCAAGACGGTTCGTTTCAACGTACTGCGCGTGCTGCCCCGGACCGGCAAGACG GTCAAGAAGTTTAGCAAGTTTTAG |
Gene | >Ophun1|3705 ATGTCAGTAATCGCAGCGCTCTCGACTCTCGTGCCTCTCGCCGCTAACTTGCGCTCAGGGCGACCGAACTCACCG TTCAATCGGAGCGTGCGTACCAGAAGCAGCCGCACATCTTCCAAAACGCCAAGGTCAAGACCAAGAGCAGCAGGC CCGGCAAGAACGGACGTCGGTGGTATAAGGATGTTGGTCTGGGCTTCCGGACGCCCAAGACGGCGATCGAGGGCA GCTATATCGGTGCGTGTGGACAATGACACTGGCGATACCCGGCGGAAACGGCTTCGACGACGCGCAGATATGCTG ATTCCCGCTCAGATAAGAAGTGCCCGTTTACCGGCCTCGTCTCGATTCGCGGCCGTATTCTGACCGGCACCGTCG TCTCCACGAAGATGCACCGAACCGTCATCGTCCGAAGAGAGTACCTGCACTTCATTCCCAAGTACTCTCGCTACG AGAAGCGCCACAAGAACCTCGCCGCACATGTTTCTCCTGCCTTCCGTGTCGAGGAGGGCGACCAGGTCACCGTTG GCCAGTGCAGGCCCCTCAGCAAGACGGTAAGTCATGTGTTGAGTGGTCGATAACGGGAAGACGGCCGGCTGACAG TGAACAGGTTCGTTTCAACGTACTGCGCGTGCTGCCCCGGACCGGCAAGACGGTCAAGAAGTTTAGCAAGTTTTA G |