Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3704
Gene name
LocationContig_330:12732..17180
Strand-
Gene length (bp)4448
Transcript length (bp)4350
Coding sequence length (bp)4350
Protein length (aa) 1450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08317 Spc7 Spc7 kinetochore protein 2.2E-79 969 1165
PF18210 Knl1_RWD_C Knl1 RWD C-terminal domain 3.9E-28 1195 1340
PF15402 MELT_2 MELT motif 7.5E-05 390 412
PF15402 MELT_2 MELT motif 1.0E-03 415 436
PF15402 MELT_2 MELT motif 2.5E-04 449 470
PF15402 MELT_2 MELT motif 4.8E-03 480 498
PF15402 MELT_2 MELT motif 3.8E-04 539 557

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59757|SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc7 PE=1 SV=1 971 1415 8.0E-36
sp|P53148|SP105_YEAST Spindle pole body component SPC105 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC105 PE=1 SV=1 1017 1360 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3704
MFPTTDSALLATRRSRKSVGANPDLRNTMDRENATLNLASSRAASRKSRSKSMGPGGLEALKQINGNRRASLAAP
VKLPRSILKPTIPPLPAIPPLKNGKKKTEKYESGGSQDSSRSLTTSSDEDSTGSKSAIRTDEEQQADTKEREERE
RRDARRKSLANRRVSFAAEATLHTFHEVEYMQDSTTSTDTTRRASSVADRTPGRTNVVGAVECQEDATKSQTGII
ACSPDKQADLQQQRRRRRSSGIQSLNANGPDDDTVASTVYSSDSEPADGVEDMAEEVEEASSSDSDDGTMMTIDT
DEATGISVASDRSGATDDDSTLDEALRIAARRASTQNLESADDNEDDDDGEEVIPSFGWIKKSTQPAAESKSLPS
VTERCESRGAGTGDDADTEMDMDMDMTQSVGRILKPFSHDDSDLLGDVSMEVTQALGGILSFNKPSTAPQVAKDQ
ELDDATMELTTIMGGIQRARSEDPDDLLDHEDMSMELTTVIGKVLTRGEPAVTSRKQETGHTDGAAIDDAVADVT
SDIGQLMADCNVQEDVTMDMDMTAALGGIIETGEKSPRTLNKRILEEEVNRPNDTTEAIVEAVTRSPTRRASRMS
QEATDSPGLSAFRGKGLRRSSIKRTSATPQRDARSRTPSPSKTAPQSPAKTTHQSPVKTTPQPPIQTVSSAPNKP
ETPQRRPSSSSKTQSETKSPKTRAASPTRRIIESQAKTPSPAKSTRGGASIFHKDPQTGDRTPNVVLTPPNRPLS
GVGIDRPGLGSPKVAALCKRRCSIGDSASEFVLGKRTVAFEEPKVIEEEVDQIRREQEDQEDRVRILEREADGSH
QDRDATLNLREMINSLSPKWKPLRGRKSLHVGSAKGLLGKRPAELDDDGDDDDDGVKRLKGHQSSPVKNVLLEQP
TVGRLTRAARRSLEQAKATSTPLLSSPIKTTTPRGQARFKDVQDNQTVHEINLHGPQAKDDVELAREVEEEKIHL
QDFLNMISIRFMELNTTKRRHTTAPGSGRDGDSSEERDGLTLERCVVAGACTVPMLELYQHSCRELKKYISEGRR
MVKEIESETLEENPPLFREYMTAGADVKALMDHQFKNVKTHARLLSKAMWYEWRMKLQEGLREGLVGIAEGMDAD
DKALKEQQDMVASVLPGIVTRYESLQEESSSLREAARELADCDPAELASAREQLMSLDADVATKKQQIAELRKQL
QDSTAEVQELGSRKMECVQAIEACEETREKYRGWTSREVKALRARVDAMEKKHGWAISGLSGSSLSMTYRREIEL
LIDVCSFKPVDVRLAAGSREQVSTDRQFMLRYIGQHVQTLSTAGASQLSELLRVVGRGWDKARLVARQISRINMV
FPTKVAQTSETSLSVTSRLLLVPLKTLIEVGLKLDGSDDNDVAVSVSARVIYGEQFNEGKMGEFLAARIGQRVEA
GQDWSDALVELRRRLVAKGGKLRA*
Coding >Ophun1|3704
ATGTTTCCGACGACTGATAGCGCTTTGCTCGCGACGCGTCGCAGTCGAAAGTCCGTCGGCGCGAACCCGGATCTA
CGAAACACGATGGACCGGGAGAACGCGACGCTCAACCTGGCCAGCTCGAGAGCTGCCAGTCGCAAGTCCAGGAGC
AAGAGTATGGGCCCTGGCGGACTAGAAGCTCTGAAGCAGATCAACGGGAACAGACGCGCTTCTCTGGCGGCTCCT
GTAAAGCTTCCGCGATCGATCCTGAAGCCAACTATACCCCCTCTTCCCGCGATACCCCCCTTGAAGAACGGGAAG
AAAAAGACAGAAAAGTATGAGAGTGGCGGAAGTCAAGACTCGTCTCGCAGTCTCACCACCTCCAGCGACGAGGAT
TCCACTGGATCCAAGTCGGCTATTCGCACAGACGAGGAACAACAAGCGGATACAAAGGAGAGAGAGGAGCGCGAG
AGGCGCGATGCTCGTCGAAAGTCGCTCGCGAATCGAAGAGTCTCTTTCGCGGCCGAGGCTACGCTCCATACCTTT
CACGAAGTCGAATACATGCAAGACTCCACGACGTCTACGGACACGACCCGAAGAGCCTCGTCCGTTGCCGACAGG
ACCCCTGGCCGGACCAACGTTGTCGGTGCTGTCGAATGTCAAGAAGACGCCACAAAGTCCCAGACGGGCATCATA
GCTTGCTCTCCGGATAAGCAGGCAGACTTACAACAGCAGCGCAGGCGGCGCAGGAGCTCCGGAATCCAATCACTC
AACGCAAACGGTCCAGATGACGACACAGTGGCTTCTACAGTCTACAGCTCCGACTCGGAGCCTGCAGATGGCGTC
GAGGACATGGCCGAAGAAGTAGAAGAAGCCTCTAGCAGCGACTCGGACGACGGAACCATGATGACCATTGACACG
GATGAGGCCACCGGCATCTCGGTCGCCTCGGACCGCTCCGGCGCTACGGACGATGACTCAACACTGGATGAAGCT
CTTCGAATCGCGGCACGCAGGGCGAGCACGCAGAATCTTGAGAGTGCCGACGACAACGAGGATGACGATGACGGA
GAGGAGGTCATTCCATCGTTTGGATGGATCAAGAAGAGCACTCAACCAGCTGCCGAATCAAAAAGTCTCCCGAGT
GTGACTGAGCGATGTGAAAGTCGGGGCGCTGGAACCGGCGATGATGCAGATACGGAGATGGACATGGACATGGAC
ATGACGCAATCCGTTGGGCGGATCCTGAAACCTTTCAGCCACGACGACTCGGATCTACTTGGCGATGTGTCGATG
GAGGTTACGCAGGCTCTTGGAGGCATTTTGTCGTTTAACAAGCCGTCAACTGCTCCTCAAGTCGCGAAGGACCAA
GAGTTGGACGATGCCACCATGGAGTTGACGACCATCATGGGCGGTATACAGCGTGCCCGGAGCGAAGATCCGGAT
GACTTGCTGGACCACGAGGATATGTCGATGGAGCTGACAACAGTCATCGGCAAGGTTCTCACCAGGGGCGAGCCG
GCAGTTACCAGCCGAAAGCAGGAAACTGGCCACACAGATGGAGCGGCTATCGACGATGCAGTTGCGGATGTCACG
TCTGATATCGGCCAGCTGATGGCTGACTGCAATGTTCAAGAAGATGTGACCATGGACATGGACATGACAGCTGCC
CTGGGAGGCATCATAGAGACCGGAGAGAAGAGCCCGCGGACTCTCAATAAGCGCATCCTGGAAGAGGAGGTCAAC
AGGCCCAACGACACGACCGAGGCCATCGTTGAGGCTGTGACTCGTTCGCCGACGCGAAGAGCCTCTCGAATGTCC
CAAGAGGCAACCGATAGTCCTGGATTGTCAGCCTTTCGAGGGAAAGGCTTGCGCCGCAGCTCAATTAAGCGGACG
TCGGCGACGCCTCAGCGGGATGCCCGATCGCGGACTCCATCTCCCAGCAAGACAGCGCCTCAGTCTCCTGCAAAG
ACGACACATCAGTCTCCCGTCAAGACAACCCCGCAACCGCCAATCCAGACGGTATCATCGGCTCCCAACAAACCT
GAGACGCCTCAGCGACGGCCTTCCTCCAGCTCCAAGACTCAGTCCGAGACGAAAAGCCCGAAGACGCGGGCAGCT
TCACCTACGAGACGCATCATCGAGAGCCAGGCAAAAACACCGTCACCTGCAAAATCGACCCGAGGAGGGGCCTCC
ATCTTCCACAAGGACCCTCAGACGGGAGACCGCACACCGAATGTCGTTTTGACGCCTCCCAATCGACCACTCTCC
GGCGTTGGGATCGATCGGCCCGGGCTGGGGTCTCCCAAAGTTGCGGCGCTATGCAAACGTCGCTGTTCGATAGGA
GACTCGGCATCCGAGTTTGTTCTCGGCAAGCGAACGGTAGCCTTTGAAGAGCCCAAGGTGATTGAGGAAGAGGTA
GATCAGATTCGGCGAGAGCAAGAGGATCAGGAAGATCGAGTCAGGATTCTCGAGCGCGAAGCAGACGGGTCACAT
CAGGACAGAGACGCGACACTCAACCTCCGGGAGATGATCAACAGCCTGAGCCCGAAATGGAAGCCTCTGAGAGGT
CGCAAGAGTCTTCACGTGGGCAGCGCCAAGGGCCTCTTGGGCAAGCGACCGGCTGAACTGGACGACGACGGCGAC
GACGACGACGACGGGGTGAAGCGGCTTAAGGGACACCAGAGTAGCCCCGTCAAGAACGTGCTGCTAGAACAGCCA
ACGGTCGGTCGTCTGACGAGAGCGGCGCGGAGGAGCCTCGAGCAGGCCAAGGCCACTTCGACGCCTCTACTCTCC
TCGCCAATCAAGACGACGACGCCCCGGGGCCAAGCGCGGTTCAAGGACGTACAGGACAATCAGACGGTGCATGAG
ATCAATCTCCATGGTCCGCAGGCCAAAGACGACGTCGAGCTTGCGCGAGAAGTCGAAGAGGAAAAGATTCATCTG
CAGGACTTTCTCAACATGATCTCCATCCGCTTCATGGAGCTGAACACGACCAAGCGCCGTCACACTACGGCCCCA
GGCAGCGGCCGCGACGGAGACTCAAGCGAGGAGCGAGACGGACTGACGCTGGAGCGCTGCGTGGTGGCGGGCGCC
TGCACGGTTCCCATGCTGGAGCTCTACCAGCACTCGTGTCGAGAGCTGAAGAAGTACATTTCCGAGGGCAGGCGG
ATGGTCAAGGAGATTGAAAGCGAGACGCTCGAGGAGAATCCGCCGCTGTTCCGCGAGTACATGACGGCCGGGGCC
GATGTCAAGGCTCTCATGGATCATCAGTTCAAGAACGTCAAGACGCACGCCCGGCTTCTCAGCAAGGCCATGTGG
TACGAGTGGCGGATGAAGCTACAAGAGGGCCTCAGAGAAGGGCTCGTCGGAATCGCTGAGGGGATGGACGCGGAT
GACAAGGCCCTCAAGGAGCAGCAAGACATGGTGGCTTCTGTCCTACCTGGTATCGTGACGCGCTACGAGTCTCTA
CAGGAGGAGAGCAGCAGTCTACGAGAAGCCGCTCGAGAACTGGCCGACTGCGATCCTGCCGAGCTCGCGTCGGCA
CGAGAGCAGCTCATGAGCCTCGATGCAGACGTCGCCACCAAGAAGCAGCAGATTGCCGAACTGCGAAAGCAGCTT
CAGGACTCAACCGCCGAGGTGCAGGAGCTGGGATCGAGGAAGATGGAGTGCGTACAAGCCATCGAGGCGTGCGAG
GAGACGAGGGAGAAGTACCGCGGCTGGACGAGCAGAGAAGTCAAGGCGCTCAGAGCACGCGTCGATGCCATGGAG
AAGAAGCACGGCTGGGCCATCTCTGGCCTGTCTGGGAGCAGTCTGTCTATGACGTACCGAAGGGAGATTGAGCTG
CTGATCGACGTCTGCTCGTTCAAGCCTGTCGACGTGCGGCTCGCTGCCGGGAGCCGAGAGCAGGTCAGCACGGAC
AGGCAGTTTATGCTACGTTATATCGGGCAGCACGTTCAAACGCTCTCTACGGCCGGGGCAAGCCAGCTTTCTGAG
CTGCTACGCGTGGTGGGAAGGGGATGGGATAAGGCACGGCTGGTGGCGCGGCAGATCAGCCGCATCAACATGGTA
TTCCCGACAAAGGTAGCCCAGACATCGGAGACGAGCCTGTCCGTGACGAGCAGGCTACTACTGGTGCCGCTCAAG
ACGCTGATCGAGGTCGGGCTGAAGCTCGACGGCTCAGACGACAACGACGTGGCCGTCTCCGTCTCGGCACGCGTC
ATCTACGGCGAGCAGTTTAACGAGGGCAAGATGGGGGAATTCCTGGCGGCGCGGATTGGACAGCGGGTTGAGGCG
GGTCAGGACTGGAGTGATGCCCTTGTTGAGCTGAGGAGGCGGCTTGTTGCCAAGGGGGGGAAGTTGAGGGCCTGA
Transcript >Ophun1|3704
ATGTTTCCGACGACTGATAGCGCTTTGCTCGCGACGCGTCGCAGTCGAAAGTCCGTCGGCGCGAACCCGGATCTA
CGAAACACGATGGACCGGGAGAACGCGACGCTCAACCTGGCCAGCTCGAGAGCTGCCAGTCGCAAGTCCAGGAGC
AAGAGTATGGGCCCTGGCGGACTAGAAGCTCTGAAGCAGATCAACGGGAACAGACGCGCTTCTCTGGCGGCTCCT
GTAAAGCTTCCGCGATCGATCCTGAAGCCAACTATACCCCCTCTTCCCGCGATACCCCCCTTGAAGAACGGGAAG
AAAAAGACAGAAAAGTATGAGAGTGGCGGAAGTCAAGACTCGTCTCGCAGTCTCACCACCTCCAGCGACGAGGAT
TCCACTGGATCCAAGTCGGCTATTCGCACAGACGAGGAACAACAAGCGGATACAAAGGAGAGAGAGGAGCGCGAG
AGGCGCGATGCTCGTCGAAAGTCGCTCGCGAATCGAAGAGTCTCTTTCGCGGCCGAGGCTACGCTCCATACCTTT
CACGAAGTCGAATACATGCAAGACTCCACGACGTCTACGGACACGACCCGAAGAGCCTCGTCCGTTGCCGACAGG
ACCCCTGGCCGGACCAACGTTGTCGGTGCTGTCGAATGTCAAGAAGACGCCACAAAGTCCCAGACGGGCATCATA
GCTTGCTCTCCGGATAAGCAGGCAGACTTACAACAGCAGCGCAGGCGGCGCAGGAGCTCCGGAATCCAATCACTC
AACGCAAACGGTCCAGATGACGACACAGTGGCTTCTACAGTCTACAGCTCCGACTCGGAGCCTGCAGATGGCGTC
GAGGACATGGCCGAAGAAGTAGAAGAAGCCTCTAGCAGCGACTCGGACGACGGAACCATGATGACCATTGACACG
GATGAGGCCACCGGCATCTCGGTCGCCTCGGACCGCTCCGGCGCTACGGACGATGACTCAACACTGGATGAAGCT
CTTCGAATCGCGGCACGCAGGGCGAGCACGCAGAATCTTGAGAGTGCCGACGACAACGAGGATGACGATGACGGA
GAGGAGGTCATTCCATCGTTTGGATGGATCAAGAAGAGCACTCAACCAGCTGCCGAATCAAAAAGTCTCCCGAGT
GTGACTGAGCGATGTGAAAGTCGGGGCGCTGGAACCGGCGATGATGCAGATACGGAGATGGACATGGACATGGAC
ATGACGCAATCCGTTGGGCGGATCCTGAAACCTTTCAGCCACGACGACTCGGATCTACTTGGCGATGTGTCGATG
GAGGTTACGCAGGCTCTTGGAGGCATTTTGTCGTTTAACAAGCCGTCAACTGCTCCTCAAGTCGCGAAGGACCAA
GAGTTGGACGATGCCACCATGGAGTTGACGACCATCATGGGCGGTATACAGCGTGCCCGGAGCGAAGATCCGGAT
GACTTGCTGGACCACGAGGATATGTCGATGGAGCTGACAACAGTCATCGGCAAGGTTCTCACCAGGGGCGAGCCG
GCAGTTACCAGCCGAAAGCAGGAAACTGGCCACACAGATGGAGCGGCTATCGACGATGCAGTTGCGGATGTCACG
TCTGATATCGGCCAGCTGATGGCTGACTGCAATGTTCAAGAAGATGTGACCATGGACATGGACATGACAGCTGCC
CTGGGAGGCATCATAGAGACCGGAGAGAAGAGCCCGCGGACTCTCAATAAGCGCATCCTGGAAGAGGAGGTCAAC
AGGCCCAACGACACGACCGAGGCCATCGTTGAGGCTGTGACTCGTTCGCCGACGCGAAGAGCCTCTCGAATGTCC
CAAGAGGCAACCGATAGTCCTGGATTGTCAGCCTTTCGAGGGAAAGGCTTGCGCCGCAGCTCAATTAAGCGGACG
TCGGCGACGCCTCAGCGGGATGCCCGATCGCGGACTCCATCTCCCAGCAAGACAGCGCCTCAGTCTCCTGCAAAG
ACGACACATCAGTCTCCCGTCAAGACAACCCCGCAACCGCCAATCCAGACGGTATCATCGGCTCCCAACAAACCT
GAGACGCCTCAGCGACGGCCTTCCTCCAGCTCCAAGACTCAGTCCGAGACGAAAAGCCCGAAGACGCGGGCAGCT
TCACCTACGAGACGCATCATCGAGAGCCAGGCAAAAACACCGTCACCTGCAAAATCGACCCGAGGAGGGGCCTCC
ATCTTCCACAAGGACCCTCAGACGGGAGACCGCACACCGAATGTCGTTTTGACGCCTCCCAATCGACCACTCTCC
GGCGTTGGGATCGATCGGCCCGGGCTGGGGTCTCCCAAAGTTGCGGCGCTATGCAAACGTCGCTGTTCGATAGGA
GACTCGGCATCCGAGTTTGTTCTCGGCAAGCGAACGGTAGCCTTTGAAGAGCCCAAGGTGATTGAGGAAGAGGTA
GATCAGATTCGGCGAGAGCAAGAGGATCAGGAAGATCGAGTCAGGATTCTCGAGCGCGAAGCAGACGGGTCACAT
CAGGACAGAGACGCGACACTCAACCTCCGGGAGATGATCAACAGCCTGAGCCCGAAATGGAAGCCTCTGAGAGGT
CGCAAGAGTCTTCACGTGGGCAGCGCCAAGGGCCTCTTGGGCAAGCGACCGGCTGAACTGGACGACGACGGCGAC
GACGACGACGACGGGGTGAAGCGGCTTAAGGGACACCAGAGTAGCCCCGTCAAGAACGTGCTGCTAGAACAGCCA
ACGGTCGGTCGTCTGACGAGAGCGGCGCGGAGGAGCCTCGAGCAGGCCAAGGCCACTTCGACGCCTCTACTCTCC
TCGCCAATCAAGACGACGACGCCCCGGGGCCAAGCGCGGTTCAAGGACGTACAGGACAATCAGACGGTGCATGAG
ATCAATCTCCATGGTCCGCAGGCCAAAGACGACGTCGAGCTTGCGCGAGAAGTCGAAGAGGAAAAGATTCATCTG
CAGGACTTTCTCAACATGATCTCCATCCGCTTCATGGAGCTGAACACGACCAAGCGCCGTCACACTACGGCCCCA
GGCAGCGGCCGCGACGGAGACTCAAGCGAGGAGCGAGACGGACTGACGCTGGAGCGCTGCGTGGTGGCGGGCGCC
TGCACGGTTCCCATGCTGGAGCTCTACCAGCACTCGTGTCGAGAGCTGAAGAAGTACATTTCCGAGGGCAGGCGG
ATGGTCAAGGAGATTGAAAGCGAGACGCTCGAGGAGAATCCGCCGCTGTTCCGCGAGTACATGACGGCCGGGGCC
GATGTCAAGGCTCTCATGGATCATCAGTTCAAGAACGTCAAGACGCACGCCCGGCTTCTCAGCAAGGCCATGTGG
TACGAGTGGCGGATGAAGCTACAAGAGGGCCTCAGAGAAGGGCTCGTCGGAATCGCTGAGGGGATGGACGCGGAT
GACAAGGCCCTCAAGGAGCAGCAAGACATGGTGGCTTCTGTCCTACCTGGTATCGTGACGCGCTACGAGTCTCTA
CAGGAGGAGAGCAGCAGTCTACGAGAAGCCGCTCGAGAACTGGCCGACTGCGATCCTGCCGAGCTCGCGTCGGCA
CGAGAGCAGCTCATGAGCCTCGATGCAGACGTCGCCACCAAGAAGCAGCAGATTGCCGAACTGCGAAAGCAGCTT
CAGGACTCAACCGCCGAGGTGCAGGAGCTGGGATCGAGGAAGATGGAGTGCGTACAAGCCATCGAGGCGTGCGAG
GAGACGAGGGAGAAGTACCGCGGCTGGACGAGCAGAGAAGTCAAGGCGCTCAGAGCACGCGTCGATGCCATGGAG
AAGAAGCACGGCTGGGCCATCTCTGGCCTGTCTGGGAGCAGTCTGTCTATGACGTACCGAAGGGAGATTGAGCTG
CTGATCGACGTCTGCTCGTTCAAGCCTGTCGACGTGCGGCTCGCTGCCGGGAGCCGAGAGCAGGTCAGCACGGAC
AGGCAGTTTATGCTACGTTATATCGGGCAGCACGTTCAAACGCTCTCTACGGCCGGGGCAAGCCAGCTTTCTGAG
CTGCTACGCGTGGTGGGAAGGGGATGGGATAAGGCACGGCTGGTGGCGCGGCAGATCAGCCGCATCAACATGGTA
TTCCCGACAAAGGTAGCCCAGACATCGGAGACGAGCCTGTCCGTGACGAGCAGGCTACTACTGGTGCCGCTCAAG
ACGCTGATCGAGGTCGGGCTGAAGCTCGACGGCTCAGACGACAACGACGTGGCCGTCTCCGTCTCGGCACGCGTC
ATCTACGGCGAGCAGTTTAACGAGGGCAAGATGGGGGAATTCCTGGCGGCGCGGATTGGACAGCGGGTTGAGGCG
GGTCAGGACTGGAGTGATGCCCTTGTTGAGCTGAGGAGGCGGCTTGTTGCCAAGGGGGGGAAGTTGAGGGCCTGA
Gene >Ophun1|3704
ATGTTTCCGACGACTGATAGCGCTTTGCTCGCGACGCGTCGCAGTCGAAAGTCCGTCGGCGCGAACCCGGATCTA
CGAAACACGATGGACCGGGAGAACGCGACGCTCAACCTGGCCAGCTCGAGAGCTGCCAGTCGCAAGTCCAGGAGC
AAGAGTATGGGCCCTGGCGGACTAGAAGCTCTGAAGCAGATCAACGGGAACAGACGCGCTGTAAGTGTAGTAACT
TCACAGCTTTGTCATGCCACTGACGGTGTTGTAGTCTCTGGCGGCTCCTGTAAAGCTTCCGCGATCGATCCTGAA
GCCAACTATACCCCCTCTTCCCGCGATACCCCCCTTGAAGAACGGGAAGAAAAAGACAGAAAAGTATGAGAGTGG
CGGAAGTCAAGACTCGTCTCGCAGTCTCACCACCTCCAGCGACGAGGATTCCACTGGATCCAAGTCGGCTATTCG
CACAGACGAGGAACAACAAGCGGATACAAAGGAGAGAGAGGAGCGCGAGAGGCGCGATGCTCGTCGAAAGTCGCT
CGCGAATCGAAGAGTCTCTTTCGCGGCCGAGGCTACGCTCCATACCTTTCACGAAGTCGAATACATGCAAGACTC
CACGACGTCTACGGACACGACCCGAAGAGCCTCGTCCGTTGCCGACAGGACCCCTGGCCGGACCAACGTTGTCGG
TGCTGTCGAATGTCAAGAAGACGCCACAAAGTCCCAGACGGGCATCATAGCTTGCTCTCCGGATAAGCAGGCAGA
CTTACAACAGCAGCGCAGGCGGCGCAGGAGCTCCGGAATCCAATCACTCAACGCAAACGGTCCAGATGACGACAC
AGTGGCTTCTACAGTCTACAGCTCCGACTCGGAGCCTGCAGATGGCGTCGAGGACATGGCCGAAGAAGTAGAAGA
AGCCTCTAGCAGCGACTCGGACGACGGAACCATGATGACCATTGACACGGATGAGGCCACCGGCATCTCGGTCGC
CTCGGACCGCTCCGGCGCTACGGACGATGACTCAACACTGGATGAAGCTCTTCGAATCGCGGCACGCAGGGCGAG
CACGCAGAATCTTGAGAGTGCCGACGACAACGAGGATGACGATGACGGAGAGGAGGTCATTCCATCGTTTGGATG
GATCAAGAAGAGCACTCAACCAGCTGCCGAATCAAAAAGTCTCCCGAGTGTGACTGAGCGATGTGAAAGTCGGGG
CGCTGGAACCGGCGATGATGCAGATACGGAGATGGACATGGACATGGACATGACGCAATCCGTTGGGCGGATCCT
GAAACCTTTCAGCCACGACGACTCGGATCTACTTGGCGATGTGTCGATGGAGGTTACGCAGGCTCTTGGAGGCAT
TTTGTCGTTTAACAAGCCGTCAACTGCTCCTCAAGTCGCGAAGGACCAAGAGTTGGACGATGCCACCATGGAGTT
GACGACCATCATGGGCGGTATACAGCGTGCCCGGAGCGAAGATCCGGATGACTTGCTGGACCACGAGGATATGTC
GATGGAGCTGACAACAGTCATCGGCAAGGTTCTCACCAGGGGCGAGCCGGCAGTTACCAGCCGAAAGCAGGAAAC
TGGCCACACAGATGGAGCGGCTATCGACGATGCAGTTGCGGATGTCACGTCTGATATCGGCCAGCTGATGGCTGA
CTGCAATGTTCAAGAAGATGTGACCATGGACATGGACATGACAGCTGCCCTGGGAGGCATCATAGAGACCGGAGA
GAAGAGCCCGCGGACTCTCAATAAGCGCATCCTGGAAGAGGAGGTCAACAGGCCCAACGACACGACCGAGGCCAT
CGTTGAGGCTGTGACTCGTTCGCCGACGCGAAGAGCCTCTCGAATGTCCCAAGAGGCAACCGATAGTCCTGGATT
GTCAGCCTTTCGAGGGAAAGGCTTGCGCCGCAGCTCAATTAAGCGGACGTCGGCGACGCCTCAGCGGGATGCCCG
ATCGCGGACTCCATCTCCCAGCAAGACAGCGCCTCAGTCTCCTGCAAAGACGACACATCAGTCTCCCGTCAAGAC
AACCCCGCAACCGCCAATCCAGACGGTATCATCGGCTCCCAACAAACCTGAGACGCCTCAGCGACGGCCTTCCTC
CAGCTCCAAGACTCAGTCCGAGACGAAAAGCCCGAAGACGCGGGCAGCTTCACCTACGAGACGCATCATCGAGAG
CCAGGCAAAAACACCGTCACCTGCAAAATCGACCCGAGGAGGGGCCTCCATCTTCCACAAGGACCCTCAGACGGG
AGACCGCACACCGAATGTCGTTTTGACGCCTCCCAATCGACCACTCTCCGGCGTTGGGATCGATCGGCCCGGGCT
GGGGTCTCCCAAAGTTGCGGCGCTATGCAAACGTCGCTGTTCGATAGGAGACTCGGCATCCGAGTTTGTTCTCGG
CAAGCGAACGGTAGCCTTTGAAGAGCCCAAGGTGATTGAGGAAGAGGTAGATCAGATTCGGCGAGAGCAAGAGGA
TCAGGAAGATCGAGTCAGGATTCTCGAGCGCGAAGCAGACGGGTCACATCAGGACAGAGACGCGACACTCAACCT
CCGGGAGATGATCAACAGCCTGAGCCCGAAATGGAAGCCTCTGAGAGGTCGCAAGAGTCTTCACGTGGGCAGCGC
CAAGGGCCTCTTGGGCAAGCGACCGGCTGAACTGGACGACGACGGCGACGACGACGACGACGGGGTGAAGCGGCT
TAAGGGACACCAGAGTAGCCCCGTCAAGAACGTGCTGCTAGAACAGCCAACGGTCGGTCGTCTGACGAGAGCGGC
GCGGAGGAGCCTCGAGCAGGCCAAGGCCACTTCGACGCCTCTACTCTCCTCGCCAATCAAGACGACGACGCCCCG
GGGCCAAGCGCGGTTCAAGGACGTACAGGACAATCAGACGGTGCATGAGATCAATCTCCATGGTCCGCAGGCCAA
AGACGACGTCGAGCTTGCGCGAGAAGTCGAAGAGGAAAAGATTCATCTGCAGGACTTTCTCAACATGATCTCCAT
CCGCTTCATGGAGCTGAACACGACCAAGCGCCGTCACACTACGGCCCCAGGCAGCGGCCGCGACGGAGACTCAAG
CGAGGAGCGAGACGGACTGACGCTGGAGCGCTGCGTGGTGGCGGGCGCCTGCACGGTTCCCATGCTGGAGCTCTA
CCAGCACTCGTGTCGAGAGCTGAAGAAGTACATTTCCGAGGGCAGGCGGATGGTCAAGGAGATTGAAAGCGAGAC
GCTCGAGGAGAATCCGCCGCTGTTCCGCGAGTACATGACGGCCGGGGCCGATGTCAAGGCTCTCATGGATCATCA
GTTCAAGAACGTCAAGACGCACGCCCGGCTTCTCAGCAAGGCCATGTGGTACGAGTGGCGGATGAAGCTACAAGA
GGGCCTCAGAGAAGGGCTCGTCGGAATCGCTGAGGGGATGGACGCGGATGACAAGGCCCTCAAGGAGCAGCAAGA
CATGGTGGCTTCTGTCCTACCTGGTATCGTGACGCGCTACGAGTCTCTACAGGAGGAGAGCAGCAGTCTACGAGA
AGCCGCTCGAGAACTGGCCGACTGCGATCCTGCCGAGCTCGCGTCGGCACGAGAGCAGCTCATGAGCCTCGATGC
AGACGTCGCCACCAAGAAGCAGCAGATTGCCGAACTGCGAAAGCAGCTTCAGGACTCAACCGCCGAGGTGCAGGA
GCTGGGATCGAGGAAGATGGAGTGCGTACAAGCCATCGAGGCGTGCGAGGAGACGAGGGAGAAGTACCGCGGCTG
GACGAGCAGAGAAGTCAAGGCGCTCAGAGGTAAGTCATCAAGGCGGCCATCGTCTCTATTGATGCTGACGAGGCA
CAGCACGCGTCGATGCCATGGAGAAGAAGCACGGCTGGGCCATCTCTGGCCTGTCTGGGAGCAGTCTGTCTATGA
CGTACCGAAGGGAGATTGAGCTGCTGATCGACGTCTGCTCGTTCAAGCCTGTCGACGTGCGGCTCGCTGCCGGGA
GCCGAGAGCAGGTCAGCACGGACAGGCAGTTTATGCTACGTTATATCGGGCAGCACGTTCAAACGCTCTCTACGG
CCGGGGCAAGCCAGCTTTCTGAGCTGCTACGCGTGGTGGGAAGGGGATGGGATAAGGCACGGCTGGTGGCGCGGC
AGATCAGCCGCATCAACATGGTATTCCCGACAAAGGTAGCCCAGACATCGGAGACGAGCCTGTCCGTGACGAGCA
GGCTACTACTGGTGCCGCTCAAGACGCTGATCGAGGTCGGGCTGAAGCTCGACGGCTCAGACGACAACGACGTGG
CCGTCTCCGTCTCGGCACGCGTCATCTACGGCGAGCAGTTTAACGAGGGCAAGATGGGGGAATTCCTGGCGGCGC
GGATTGGACAGCGGGTTGAGGCGGGTCAGGACTGGAGTGATGCCCTTGTTGAGCTGAGGAGGCGGCTTGTTGCCA
AGGGGGGGAAGTTGAGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail