Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3701
Gene name
LocationContig_33:55281..57383
Strand-
Gene length (bp)2102
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 8.1E-109 123 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7KAM9|AT221_PENRW Autophagy-related protein 22-1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-1 PE=3 SV=1 181 602 9.0E-18
sp|Q7SG38|ATG22_NEUCR Autophagy-related protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-11 PE=3 SV=1 386 588 3.0E-17
sp|Q6CD56|ATG22_YARLI Autophagy-related protein 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG22 PE=3 SV=1 334 594 8.0E-17
sp|A7KAK4|ATG22_PICAN Autophagy-related protein 22 OS=Pichia angusta GN=ATG22 PE=3 SV=1 149 594 1.0E-16
sp|Q6FX92|ATG22_CANGA Autophagy-related protein 22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG22 PE=3 SV=1 374 599 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7KAM9|AT221_PENRW Autophagy-related protein 22-1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-1 PE=3 SV=1 181 602 9.0E-18
sp|Q7SG38|ATG22_NEUCR Autophagy-related protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-11 PE=3 SV=1 386 588 3.0E-17
sp|Q6CD56|ATG22_YARLI Autophagy-related protein 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG22 PE=3 SV=1 334 594 8.0E-17
sp|A7KAK4|ATG22_PICAN Autophagy-related protein 22 OS=Pichia angusta GN=ATG22 PE=3 SV=1 149 594 1.0E-16
sp|Q6FX92|ATG22_CANGA Autophagy-related protein 22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG22 PE=3 SV=1 374 599 3.0E-16
sp|Q51IZ9|ATG22_MAGO7 Autophagy-related protein 22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG22 PE=3 SV=1 123 584 3.0E-16
sp|Q2HFE0|ATG22_CHAGB Autophagy-related protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG22 PE=3 SV=2 386 584 2.0E-15
sp|Q0TWF4|AT221_PHANO Autophagy-related protein 22-1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-1 PE=3 SV=2 388 587 3.0E-15
sp|A7TFA9|ATG22_VANPO Autophagy-related protein 22 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG22 PE=3 SV=1 312 549 7.0E-15
sp|Q751W1|ATG22_ASHGO Autophagy-related protein 22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG22 PE=3 SV=1 373 584 3.0E-14
sp|Q2UMJ2|AT221_ASPOR Autophagy-related protein 22-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-1 PE=3 SV=1 181 560 5.0E-14
sp|Q0CL24|AT222_ASPTN Autophagy-related protein 22-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-2 PE=3 SV=1 345 560 8.0E-14
sp|Q0U103|AT222_PHANO Autophagy-related protein 22-2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG22-2 PE=3 SV=2 158 594 2.0E-13
sp|A1C5W7|AT222_ASPCL Autophagy-related protein 22-2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-2 PE=3 SV=1 166 594 9.0E-13
sp|P0CM32|ATG22_CRYNJ Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG22 PE=3 SV=1 124 596 1.0E-12
sp|P0CM33|ATG22_CRYNB Autophagy-related protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG22 PE=3 SV=1 124 596 1.0E-12
sp|Q4WZY1|AT222_ASPFU Autophagy-related protein 22-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-2 PE=3 SV=1 178 573 1.0E-12
sp|Q6CUZ1|ATG22_KLULA Autophagy-related protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG22 PE=3 SV=1 312 559 4.0E-12
sp|A1DI95|AT222_NEOFI Autophagy-related protein 22-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-2 PE=3 SV=1 123 602 4.0E-12
sp|Q5AW93|AT221_EMENI Autophagy-related protein 22-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-1 PE=3 SV=2 375 560 4.0E-12
sp|Q5AVT9|AT222_EMENI Autophagy-related protein 22-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg22-2 PE=3 SV=1 370 598 2.0E-11
sp|Q2UD74|AT222_ASPOR Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg22-2 PE=3 SV=2 387 596 2.0E-11
sp|A7KAN0|AT222_PENRW Autophagy-related protein 22-2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg22-2 PE=3 SV=1 376 600 2.0E-11
sp|A6ZTF2|ATG22_YEAS7 Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG22 PE=3 SV=1 378 551 4.0E-11
sp|P25568|ATG22_YEAST Autophagy-related protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG22 PE=1 SV=1 378 551 4.0E-11
sp|A6SSM3|AT221_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=atg22 PE=3 SV=1 143 598 6.0E-11
sp|A2QFJ9|AT221_ASPNC Autophagy-related protein 22-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-1 PE=3 SV=2 345 560 1.0E-10
sp|A2QTX8|AT222_ASPNC Autophagy-related protein 22-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg22-2 PE=3 SV=1 387 584 1.0E-10
sp|Q0CEJ5|AT221_ASPTN Autophagy-related protein 22-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg22-1 PE=3 SV=2 387 598 1.0E-10
sp|A7E7N1|AT221_SCLS1 Autophagy-related protein 22-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-1 PE=3 SV=1 143 598 2.0E-10
sp|A1C7M3|AT221_ASPCL Autophagy-related protein 22-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg22-1 PE=3 SV=1 178 602 3.0E-10
sp|Q4WH97|AT221_ASPFU Autophagy-related protein 22-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg22-1 PE=3 SV=1 181 593 3.0E-10
sp|A7EXE6|AT222_SCLS1 Autophagy-related protein 22-2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg22-2 PE=3 SV=1 373 586 6.0E-10
sp|A6S3R7|AT222_BOTFB Autophagy-related protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=ATG22 PE=3 SV=2 373 586 7.0E-10
sp|A1DG37|AT221_NEOFI Autophagy-related protein 22-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg22-1 PE=3 SV=1 345 593 1.0E-09
sp|Q1E8Z0|ATG22_COCIM Autophagy-related protein 22 OS=Coccidioides immitis (strain RS) GN=ATG22 PE=3 SV=3 181 560 8.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 176 198 22
3 210 229 19
4 234 256 22
5 300 322 22
6 332 354 22
7 393 415 22
8 425 447 22
9 459 476 17
10 491 513 22
11 526 548 22
12 558 576 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3701
MSQPTTTTTRRVTIHESAKPAPLYPIKTASSRSSTTTSWSQHSSYSYSTSTTSRSSTGTSTSRTLSRLLSALPWK
RRREDRVFAGVRVSSPRIAGSEAWVSAWGPGSKRGRLLDDWGMVGACRELRAWYLYYVGANGLALFNLAPALLQA
ILTQAASSAPSQRLILNGRPHDVESIVLLANGASFAAQAVLLLVIGAYADFGAGTGRMLLLLLWSLVGYGVGFGW
LAVRDQSRWVLAIVLYAVGLVAYQLTLTYWTAALPGLARDAPSLRTGAAEVAPINDDDLLRKDELERSRISNMAF
WWQSVGELAMLAIVVAVLAALARGRALADPSGGLAALIAGVTACWLLLSIPWFVLEQRRPGVSVPPGQTVFGAGL
RRLADAARHMKQLRQSLIYLAGYFLLGDSLNTTVTVVSTLQNRLIGFDPLTLSALLMAGIAAQAVGIAGFWFVQR
RFELRAKTMFCAVCVAIVLLDVWGMIGNWTDGFGFRNVWELWLYQVLYGLLVCPWYSYSQIVISSVTPRGHEFLF
FSVFNVVGKASSFIGPFISSAIIDSSGSSSAPFYFLFALSFVSALGLWAFLDLEQSAAEQAAFLARKQQADVGPA
YG*
Coding >Ophun1|3701
ATGTCACAACCTACCACCACCACCACCCGCCGCGTAACCATCCACGAGAGCGCCAAGCCGGCACCACTCTACCCC
ATCAAGACGGCATCGTCGCGGAGCAGCACGACGACAAGCTGGAGTCAGCACAGCAGCTACAGCTACAGCACCAGC
ACCACCAGCAGAAGCAGCACCGGCACCAGCACCAGCAGGACGCTCTCGCGGCTGCTGTCGGCGCTGCCGTGGAAG
CGGAGGAGGGAGGACAGGGTCTTTGCCGGGGTGCGGGTGTCGTCGCCGAGGATAGCTGGGTCGGAGGCTTGGGTT
TCGGCTTGGGGGCCGGGGTCGAAGCGGGGGAGGCTTTTGGATGATTGGGGGATGGTCGGGGCTTGCAGAGAACTC
CGCGCCTGGTACCTCTACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAACCTCGCCCCAGCCCTCCTCCAAGCC
ATCCTCACGCAAGCCGCCTCGTCAGCCCCCTCCCAGCGCCTCATCCTCAACGGCCGACCCCATGACGTCGAGAGC
ATCGTCCTGCTCGCAAACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTCCTCGTCATCGGCGCGTATGCCGAC
TTCGGAGCGGGGACCGGACGCATGCTCCTCCTGCTGCTGTGGTCGCTCGTCGGCTACGGGGTGGGTTTTGGATGG
CTCGCTGTTCGTGATCAGAGCAGATGGGTTCTCGCCATTGTTCTGTATGCCGTTGGCCTCGTCGCCTATCAGCTT
ACCTTGACGTATTGGACCGCCGCTCTACCGGGACTGGCTCGGGATGCGCCGTCGCTGAGAACGGGAGCCGCCGAA
GTAGCGCCCATCAACGATGACGACCTCTTACGGAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTT
TGGTGGCAATCCGTCGGTGAACTAGCAATGCTAGCCATCGTCGTCGCCGTCCTCGCAGCCCTCGCCCGCGGCCGC
GCCCTTGCAGATCCCTCGGGCGGTCTGGCAGCCCTCATCGCGGGTGTGACCGCCTGCTGGCTCCTCCTGTCCATC
CCCTGGTTCGTCCTCGAGCAGCGCCGTCCGGGAGTCTCGGTCCCGCCGGGCCAGACCGTCTTCGGCGCCGGACTT
CGCCGTCTCGCGGACGCGGCACGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGATATTTCCTC
CTGGGCGACTCGCTCAATACGACGGTGACGGTTGTTTCGACGCTGCAGAATCGATTGATTGGCTTTGATCCGCTG
ACGCTGTCTGCTCTGCTCATGGCTGGTATCGCCGCTCAGGCCGTTGGCATCGCCGGCTTCTGGTTCGTCCAGCGA
CGGTTCGAGCTGAGGGCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCTTGCTCGACGTCTGGGGCATG
ATCGGTAACTGGACGGATGGCTTCGGCTTCCGCAACGTGTGGGAGCTGTGGCTGTACCAGGTGCTGTACGGACTG
CTGGTGTGTCCTTGGTACAGCTATTCGCAGATCGTCATCAGCTCCGTCACTCCCCGCGGCCACGAATTCCTCTTC
TTCTCCGTCTTCAACGTCGTCGGCAAGGCATCCAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCG
TCCGGTAGCTCCAGCGCGCCCTTCTACTTCCTCTTCGCCCTCAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTT
CTGGATTTGGAGCAGAGTGCGGCTGAGCAGGCTGCCTTCTTGGCTCGCAAGCAGCAGGCCGACGTGGGACCTGCA
TACGGATAG
Transcript >Ophun1|3701
ATGTCACAACCTACCACCACCACCACCCGCCGCGTAACCATCCACGAGAGCGCCAAGCCGGCACCACTCTACCCC
ATCAAGACGGCATCGTCGCGGAGCAGCACGACGACAAGCTGGAGTCAGCACAGCAGCTACAGCTACAGCACCAGC
ACCACCAGCAGAAGCAGCACCGGCACCAGCACCAGCAGGACGCTCTCGCGGCTGCTGTCGGCGCTGCCGTGGAAG
CGGAGGAGGGAGGACAGGGTCTTTGCCGGGGTGCGGGTGTCGTCGCCGAGGATAGCTGGGTCGGAGGCTTGGGTT
TCGGCTTGGGGGCCGGGGTCGAAGCGGGGGAGGCTTTTGGATGATTGGGGGATGGTCGGGGCTTGCAGAGAACTC
CGCGCCTGGTACCTCTACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAACCTCGCCCCAGCCCTCCTCCAAGCC
ATCCTCACGCAAGCCGCCTCGTCAGCCCCCTCCCAGCGCCTCATCCTCAACGGCCGACCCCATGACGTCGAGAGC
ATCGTCCTGCTCGCAAACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTCCTCGTCATCGGCGCGTATGCCGAC
TTCGGAGCGGGGACCGGACGCATGCTCCTCCTGCTGCTGTGGTCGCTCGTCGGCTACGGGGTGGGTTTTGGATGG
CTCGCTGTTCGTGATCAGAGCAGATGGGTTCTCGCCATTGTTCTGTATGCCGTTGGCCTCGTCGCCTATCAGCTT
ACCTTGACGTATTGGACCGCCGCTCTACCGGGACTGGCTCGGGATGCGCCGTCGCTGAGAACGGGAGCCGCCGAA
GTAGCGCCCATCAACGATGACGACCTCTTACGGAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTT
TGGTGGCAATCCGTCGGTGAACTAGCAATGCTAGCCATCGTCGTCGCCGTCCTCGCAGCCCTCGCCCGCGGCCGC
GCCCTTGCAGATCCCTCGGGCGGTCTGGCAGCCCTCATCGCGGGTGTGACCGCCTGCTGGCTCCTCCTGTCCATC
CCCTGGTTCGTCCTCGAGCAGCGCCGTCCGGGAGTCTCGGTCCCGCCGGGCCAGACCGTCTTCGGCGCCGGACTT
CGCCGTCTCGCGGACGCGGCACGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGATATTTCCTC
CTGGGCGACTCGCTCAATACGACGGTGACGGTTGTTTCGACGCTGCAGAATCGATTGATTGGCTTTGATCCGCTG
ACGCTGTCTGCTCTGCTCATGGCTGGTATCGCCGCTCAGGCCGTTGGCATCGCCGGCTTCTGGTTCGTCCAGCGA
CGGTTCGAGCTGAGGGCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCTTGCTCGACGTCTGGGGCATG
ATCGGTAACTGGACGGATGGCTTCGGCTTCCGCAACGTGTGGGAGCTGTGGCTGTACCAGGTGCTGTACGGACTG
CTGGTGTGTCCTTGGTACAGCTATTCGCAGATCGTCATCAGCTCCGTCACTCCCCGCGGCCACGAATTCCTCTTC
TTCTCCGTCTTCAACGTCGTCGGCAAGGCATCCAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCG
TCCGGTAGCTCCAGCGCGCCCTTCTACTTCCTCTTCGCCCTCAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTT
CTGGATTTGGAGCAGAGTGCGGCTGAGCAGGCTGCCTTCTTGGCTCGCAAGCAGCAGGCCGACGTGGGACCTGCA
TACGGATAG
Gene >Ophun1|3701
ATGTCACAACCTACCACCACCACCACCCGCCGCGTAACCATCCACGAGAGCGCCAAGCCGGCACCACTCTACCCC
ATCAAGACGGCATCGTCGCGGAGCAGCACGACGACAAGCTGGAGTCAGCACAGCAGCTACAGCTACAGCACCAGC
ACCACCAGCAGAAGCAGCACCGGCACCAGCACCAGCAGGACGCTCTCGCGGCTGCTGTCGGCGCTGCCGTGGAAG
CGGAGGAGGGAGGACAGGGTCTTTGCCGGGGTGCGGGTGTCGTCGCCGAGGATAGCTGGGTCGGAGGCTTGGGTT
TCGGCTTGGGGGCCGGGGTCGAAGCGGGGGAGGCTTTTGGATGATTGGGGGATGGTCGGGGCTTGCAGGTCTGAT
TGAGAGGTGGTTGGTTAATGGTTGGTTGGTTGGTGATGATGGGTGTTACGTCGGGGATTGTACAGGGGGTCACGG
AAAACACCACATACATTAGTTGATAGGTACAGCTGAGAATGGAAACGCCAAGCGACGACATACCACTTATCTATC
TTGCCTCCGACCTCTTCTTCTTCTTCTTCTTCTTCTCCTCCTCCTCCTCTCTCCCAACCAAACCCCCCCTTCCTC
TCCCTCTCATGGCCGCTCAACACCATCCCCACGACGCCTCCCGGCCAACAACAACCCCCAGAGAACTCCGCGCCT
GGTACCTCTACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAACCTCGCCCCAGCCCTCCTCCAAGCCATCCTCA
CGCAAGCCGCCTCGTCAGCCCCCTCCCAGCGCCTCATCCTCAACGGCCGACCCCATGACGTCGAGAGCATCGTCC
TGCTCGCAAACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTCCTCGTCATCGGCGCGTATGCCGACTTCGGAG
CGGGGACCGGACGCATGCTCCTCCTGCTGCTGTGGTCGCTCGTCGGCTACGGGGTGGGTTTTGGATGGCTCGCTG
TTCGTGATCAGAGCAGATGGGTTCTCGCCATTGTTCTGTATGCCGTTGGCCTCGTCGCCTATCAGCTTACCTTGA
CGTATTGGACCGCCGCTCTACCGGGACTGGCTCGGGATGCGCCGTCGCTGAGAACGGGAGCCGCCGAAGTAGCGC
CCATCAACGATGACGACCTCTTACGGAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTTTGGTGGC
AATCCGTCGGTGAACTAGCAATGCTAGCCATCGTCGTCGCCGTCCTCGCAGCCCTCGCCCGCGGCCGCGCCCTTG
CAGATCCCTCGGGCGGTCTGGCAGCCCTCATCGCGGGTGTGACCGCCTGCTGGCTCCTCCTGTCCATCCCCTGGT
TCGTCCTCGAGCAGCGCCGTCCGGGAGTCTCGGTCCCGCCGGGCCAGACCGTCTTCGGCGCCGGACTTCGCCGTC
TCGCGGACGCGGCACGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGATATTTCCTCCTGGGCG
ACTCGCTCAATACGACGGTGACGGTTGTTTCGACGCTGCAGAATCGATTGATTGGCTTTGATCCGCTGACGCTGT
CTGCTCTGCTCATGGCTGGTATCGCCGCTCAGGCCGTTGGCATCGCCGGCTTCTGGTTCGTCCAGCGACGGTTCG
AGCTGAGGGCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCTTGCTCGACGTCTGGGGCATGATCGGTA
ACTGGACGGATGGCTTCGGCTTCCGCAACGTGTGGGAGCTGTGGCTGTACCAGGTGCTGTACGGACTGCTGGTGT
GTCCTTGGTACAGCTATTCGCAGATCGTCATCAGCTCCGTCACTCCCCGCGGCCACGAATTCCTCTTCTTCTCCG
TCTTCAACGTCGTCGGCAAGGCATCCAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCGTCCGGTA
GCTCCAGCGCGCCCTTCTACTTCCTCTTCGCCCTCAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTTCTGGATT
TGGAGCAGAGTGCGGCTGAGCAGGCTGCCTTCTTGGCTCGCAAGCAGCAGGCCGACGTGGGACCTGCATACGGAT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail