Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3700
Gene name
LocationContig_33:53628..54882
Strand-
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.8E-20 5 348
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-04 8 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 6 357 2.0E-52
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 6 357 2.0E-52
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 4 321 3.0E-14
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 4 321 2.0E-13
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 5 351 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 6 357 2.0E-52
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 6 357 2.0E-52
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 4 321 3.0E-14
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 4 321 2.0E-13
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 5 351 7.0E-11
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 22 356 8.0E-11
sp|A5FMP6|KMO_FLAJ1 Kynurenine 3-monooxygenase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=kmo PE=3 SV=1 4 338 7.0E-10
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 5 333 2.0E-09
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 4 356 2.0E-08
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 26 353 2.0E-08
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 6 324 7.0E-08
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 111 343 1.0E-07
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 4 324 3.0E-07
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 26 353 2.0E-06
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 4 324 2.0E-06
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 6 324 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3700
MAPLEILICGGGIAGPAAAFWLSRLGHTCTIIERHPELRLGGQQIDIREQGVTVARRMGLLDDIRRRSVDELGTA
FVDRHGRRFAFFGRSGDEARQSFTSEFEIMRGDLCSILHDATAGDRVDWRFGITVDDYRHVKDGRRVSVTFSDRS
VAEYDLVIGADGQGSRVRRKMVPEDKYRALGVFCCYFNTSRQPGDTENVFSLYQPGRKRVVATRWHSPDAGQGYL
MTRSHADEMRRVLRRPDTAAQRDLFTRIFSGAGWQSDRLVREMQEARDIYAFEAVQVTANPWSRGRVVLLGDAAH
APSFFTGMGTSLALVGAYVLAGELSTHGDDVEAGLAAYDARLRSFVEDTQKLSPGVPAAMFPDTWWGVRIFQFIL
TIMGLIRIDNIVGLIFKYLKSDANQWHVPDYPMLASEKNHIM*
Coding >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA
Transcript >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA
Gene >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail