Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3700
Gene name
LocationContig_33:53628..54882
Strand-
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.8E-20 5 348
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-04 8 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 6 357 2.0E-52
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 6 357 2.0E-52
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 4 321 3.0E-14
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 4 321 2.0E-13
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 5 351 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 6 357 2.0E-52
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 6 357 2.0E-52
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 4 321 3.0E-14
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 4 321 2.0E-13
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 5 351 7.0E-11
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 22 356 8.0E-11
sp|A5FMP6|KMO_FLAJ1 Kynurenine 3-monooxygenase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=kmo PE=3 SV=1 4 338 7.0E-10
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 5 333 2.0E-09
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 4 356 2.0E-08
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 26 353 2.0E-08
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 6 324 7.0E-08
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 111 343 1.0E-07
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 4 324 3.0E-07
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 26 353 2.0E-06
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 4 324 2.0E-06
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 6 324 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup324
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3999
Ophiocordyceps australis map64 (Brazil) OphauB2|7463
Ophiocordyceps camponoti-floridani Ophcf2|03849
Ophiocordyceps camponoti-rufipedis Ophun1|3700 (this protein)
Ophiocordyceps kimflemingae Ophio5|4613
Ophiocordyceps subramaniannii Hirsu2|314
Ophiocordyceps subramaniannii Hirsu2|8010

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3700
MAPLEILICGGGIAGPAAAFWLSRLGHTCTIIERHPELRLGGQQIDIREQGVTVARRMGLLDDIRRRSVDELGTA
FVDRHGRRFAFFGRSGDEARQSFTSEFEIMRGDLCSILHDATAGDRVDWRFGITVDDYRHVKDGRRVSVTFSDRS
VAEYDLVIGADGQGSRVRRKMVPEDKYRALGVFCCYFNTSRQPGDTENVFSLYQPGRKRVVATRWHSPDAGQGYL
MTRSHADEMRRVLRRPDTAAQRDLFTRIFSGAGWQSDRLVREMQEARDIYAFEAVQVTANPWSRGRVVLLGDAAH
APSFFTGMGTSLALVGAYVLAGELSTHGDDVEAGLAAYDARLRSFVEDTQKLSPGVPAAMFPDTWWGVRIFQFIL
TIMGLIRIDNIVGLIFKYLKSDANQWHVPDYPMLASEKNHIM*
Coding >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA
Transcript >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA
Gene >Ophun1|3700
ATGGCCCCCCTCGAAATCCTCATCTGCGGCGGAGGCATCGCCGGTCCAGCAGCCGCCTTCTGGCTCTCCCGCCTC
GGCCACACCTGCACCATCATAGAGCGCCATCCCGAACTCCGCCTCGGAGGCCAGCAGATCGACATCCGCGAGCAA
GGCGTAACCGTCGCCCGTCGAATGGGCCTCCTCGATGACATCCGCCGCCGATCCGTCGACGAGCTGGGCACTGCC
TTTGTGGACCGTCACGGCCGGCGATTCGCGTTCTTCGGACGAAGCGGTGATGAGGCTCGTCAGAGCTTCACGAGC
GAATTCGAGATTATGCGCGGTGATCTCTGCAGCATCCTCCATGATGCTACGGCTGGAGATCGCGTCGATTGGCGT
TTTGGCATCACTGTCGATGACTATCGCCACGTTAAAGACGGTCGTCGCGTCAGTGTCACCTTTTCAGACCGTTCG
GTAGCAGAGTACGACCTCGTCATCGGCGCAGACGGTCAGGGATCCCGAGTCCGTCGCAAGATGGTTCCCGAAGAC
AAGTATCGCGCCCTCGGCGTCTTCTGCTGCTACTTCAACACCAGCCGCCAACCAGGCGATACCGAAAACGTCTTC
AGTCTTTACCAGCCCGGCCGGAAGCGCGTCGTTGCCACCCGTTGGCACAGTCCGGATGCCGGTCAGGGCTACCTG
ATGACGAGGTCGCATGCCGATGAGATGCGTCGCGTCCTTCGCCGCCCAGATACGGCTGCTCAGCGCGATCTCTTC
ACTCGCATCTTCTCTGGCGCGGGCTGGCAGAGTGACCGTCTGGTGCGAGAGATGCAGGAGGCTCGCGATATCTAC
GCCTTTGAGGCTGTTCAGGTTACCGCCAACCCGTGGTCCAGGGGCCGTGTCGTTCTGCTGGGAGACGCGGCACAT
GCGCCCTCCTTCTTCACCGGAATGGGCACCAGCCTGGCTCTCGTTGGAGCCTATGTCCTCGCTGGTGAGCTGTCG
ACGCATGGGGATGACGTCGAGGCTGGCCTGGCTGCCTATGACGCCCGTCTGCGAAGCTTCGTCGAGGACACGCAG
AAGCTGAGTCCTGGTGTGCCGGCTGCCATGTTCCCTGATACTTGGTGGGGAGTCCGCATCTTCCAGTTCATCCTC
ACCATCATGGGCTTGATTCGCATCGACAACATCGTCGGCCTGATCTTCAAGTACCTCAAGTCGGACGCCAACCAG
TGGCATGTGCCTGATTATCCCATGCTGGCGAGCGAGAAGAACCACATCATGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail