Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3696
Gene name
LocationContig_33:44760..46544
Strand-
Gene length (bp)1784
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-32 59 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 25 515 5.0E-87
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 21 513 5.0E-86
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 25 513 8.0E-78
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 34 513 1.0E-57
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 26 513 1.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 25 515 5.0E-87
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 21 513 5.0E-86
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 25 513 8.0E-78
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 34 513 1.0E-57
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 26 513 1.0E-56
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 12 515 3.0E-55
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 54 513 1.0E-47
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 54 504 1.0E-41
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 14 513 1.0E-36
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 3 515 2.0E-34
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 26 513 3.0E-34
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 21 514 4.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 16 496 9.0E-31
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 64 513 4.0E-22
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 54 349 3.0E-13
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 247 7.0E-13
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 247 2.0E-12
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 54 238 3.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 60 285 7.0E-12
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 97 413 3.0E-11
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 54 300 1.0E-10
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 25 493 4.0E-09
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 22 515 8.0E-09
sp|Q9V7S5|PICO_DROME Putative inorganic phosphate cotransporter OS=Drosophila melanogaster GN=Picot PE=1 SV=1 91 358 1.0E-07
sp|O61369|PICO_DROAN Putative inorganic phosphate cotransporter OS=Drosophila ananassae GN=Picot PE=3 SV=1 98 358 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 97 119 22
3 126 148 22
4 152 171 19
5 183 205 22
6 210 232 22
7 278 300 22
8 315 332 17
9 345 367 22
10 377 399 22
11 427 443 16
12 453 475 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3696
MMGHLQPIHRPAPAPEVKVGASPSESISAEDHGRLLRRIDLWCFTLSQSEPTDLLPVMAISYMFQFLDKTALGFT
AILGLPQALHLSGLAFSWASGVYYAGYLIATYPAGIIMVKWKVGKTIACSAALWGITLMLTAVVSNAAGLIAVRF
FLGVFEAPIAPGLTVIVSMWFKRNEQPLRQTAWFLGNTTAGIVGALVAYAIGHIQGIATWKAVFIIFGAFTTAWS
VGLFWLLPDVPMTAWFLSPPDRVKAVARVKDNMTGIKNDEFKWRQFREAILDINAWSIVLITMTMNMSNGGLLSF
NSIVLEGLGFDRLKTLLLQSATYLFQLFLVLVCATMSSRLKNKRLLLMVLNFLLSIIGCALVRQLPAHLKWPRYV
GYILTIAFSANYPLILSVVSANVSGFTKKVTVTSMVSVPCLSVHPDAKQKQVVMSYCAGNIIGPQFFIEAEAPSY
NSAFLAVMMCFGISAVLCLVLRFSLSRQNRARDQVQVMQGHEVDNSALNLLDKTDKELPTFRYVY*
Coding >Ophun1|3696
ATGATGGGCCATCTCCAGCCCATTCACCGGCCCGCGCCCGCCCCGGAAGTCAAGGTCGGGGCTTCGCCGTCCGAG
TCCATCTCGGCAGAGGATCATGGACGGCTCCTCCGCCGGATCGATCTTTGGTGCTTCACCCTCTCCCAGTCAGAG
CCTACAGATCTCCTGCCCGTCATGGCCATCAGCTACATGTTCCAATTCCTAGACAAGACGGCCCTCGGCTTCACC
GCCATCTTGGGCCTCCCGCAAGCCCTCCATCTCAGCGGCCTCGCCTTCTCCTGGGCCTCGGGCGTCTACTATGCC
GGCTACCTCATCGCCACCTATCCGGCCGGCATCATCATGGTAAAGTGGAAAGTCGGCAAGACAATTGCCTGCTCC
GCCGCCCTTTGGGGCATAACCTTGATGCTCACCGCCGTCGTCTCAAACGCCGCCGGCCTCATAGCAGTCCGCTTC
TTCCTCGGCGTATTCGAAGCCCCCATCGCACCGGGCCTCACCGTCATAGTATCAATGTGGTTCAAGCGGAACGAG
CAGCCCCTTCGTCAAACAGCCTGGTTTCTCGGAAACACCACCGCCGGCATCGTCGGCGCGCTGGTGGCCTATGCC
ATCGGCCACATACAAGGCATCGCCACCTGGAAGGCCGTCTTCATCATCTTTGGCGCCTTTACGACTGCCTGGTCT
GTTGGCCTCTTCTGGCTCCTCCCCGACGTCCCCATGACAGCCTGGTTTCTGTCTCCGCCCGACCGAGTCAAGGCC
GTAGCCCGGGTAAAGGACAACATGACGGGCATCAAAAACGATGAATTCAAGTGGCGACAGTTCCGCGAAGCCATC
CTCGACATCAACGCATGGAGCATCGTCCTCATCACAATGACCATGAACATGTCCAACGGCGGTCTCCTCAGCTTC
AATTCCATCGTGCTCGAGGGCCTCGGCTTCGATCGCTTGAAGACGCTACTCCTACAGAGCGCAACCTATCTCTTT
CAGCTCTTCCTCGTCCTCGTCTGCGCGACCATGAGCAGCCGGCTGAAGAACAAGCGACTGCTGCTGATGGTGCTG
AACTTCTTGTTGTCCATCATCGGCTGCGCCCTCGTCCGCCAACTTCCAGCCCACCTCAAGTGGCCTCGCTACGTC
GGATACATCCTCACCATTGCCTTCAGCGCAAACTACCCACTCATCCTATCCGTCGTATCAGCCAACGTCAGCGGT
TTCACCAAGAAGGTAACCGTCACCAGCATGGTAAGTGTCCCTTGCCTATCCGTACATCCCGATGCCAAACAGAAG
CAGGTCGTCATGTCCTACTGCGCCGGCAACATCATCGGCCCGCAGTTCTTCATCGAAGCCGAGGCGCCCTCCTAC
AACTCAGCCTTCCTAGCCGTCATGATGTGCTTCGGCATCTCCGCCGTGCTGTGTCTCGTGCTGCGCTTCTCGCTC
TCGCGGCAGAACCGAGCTCGAGATCAGGTGCAGGTCATGCAAGGCCACGAGGTCGACAACTCGGCGCTGAATCTG
CTGGATAAGACGGACAAGGAGCTGCCGACGTTTCGATATGTGTATTAG
Transcript >Ophun1|3696
ATGATGGGCCATCTCCAGCCCATTCACCGGCCCGCGCCCGCCCCGGAAGTCAAGGTCGGGGCTTCGCCGTCCGAG
TCCATCTCGGCAGAGGATCATGGACGGCTCCTCCGCCGGATCGATCTTTGGTGCTTCACCCTCTCCCAGTCAGAG
CCTACAGATCTCCTGCCCGTCATGGCCATCAGCTACATGTTCCAATTCCTAGACAAGACGGCCCTCGGCTTCACC
GCCATCTTGGGCCTCCCGCAAGCCCTCCATCTCAGCGGCCTCGCCTTCTCCTGGGCCTCGGGCGTCTACTATGCC
GGCTACCTCATCGCCACCTATCCGGCCGGCATCATCATGGTAAAGTGGAAAGTCGGCAAGACAATTGCCTGCTCC
GCCGCCCTTTGGGGCATAACCTTGATGCTCACCGCCGTCGTCTCAAACGCCGCCGGCCTCATAGCAGTCCGCTTC
TTCCTCGGCGTATTCGAAGCCCCCATCGCACCGGGCCTCACCGTCATAGTATCAATGTGGTTCAAGCGGAACGAG
CAGCCCCTTCGTCAAACAGCCTGGTTTCTCGGAAACACCACCGCCGGCATCGTCGGCGCGCTGGTGGCCTATGCC
ATCGGCCACATACAAGGCATCGCCACCTGGAAGGCCGTCTTCATCATCTTTGGCGCCTTTACGACTGCCTGGTCT
GTTGGCCTCTTCTGGCTCCTCCCCGACGTCCCCATGACAGCCTGGTTTCTGTCTCCGCCCGACCGAGTCAAGGCC
GTAGCCCGGGTAAAGGACAACATGACGGGCATCAAAAACGATGAATTCAAGTGGCGACAGTTCCGCGAAGCCATC
CTCGACATCAACGCATGGAGCATCGTCCTCATCACAATGACCATGAACATGTCCAACGGCGGTCTCCTCAGCTTC
AATTCCATCGTGCTCGAGGGCCTCGGCTTCGATCGCTTGAAGACGCTACTCCTACAGAGCGCAACCTATCTCTTT
CAGCTCTTCCTCGTCCTCGTCTGCGCGACCATGAGCAGCCGGCTGAAGAACAAGCGACTGCTGCTGATGGTGCTG
AACTTCTTGTTGTCCATCATCGGCTGCGCCCTCGTCCGCCAACTTCCAGCCCACCTCAAGTGGCCTCGCTACGTC
GGATACATCCTCACCATTGCCTTCAGCGCAAACTACCCACTCATCCTATCCGTCGTATCAGCCAACGTCAGCGGT
TTCACCAAGAAGGTAACCGTCACCAGCATGGTAAGTGTCCCTTGCCTATCCGTACATCCCGATGCCAAACAGAAG
CAGGTCGTCATGTCCTACTGCGCCGGCAACATCATCGGCCCGCAGTTCTTCATCGAAGCCGAGGCGCCCTCCTAC
AACTCAGCCTTCCTAGCCGTCATGATGTGCTTCGGCATCTCCGCCGTGCTGTGTCTCGTGCTGCGCTTCTCGCTC
TCGCGGCAGAACCGAGCTCGAGATCAGGTGCAGGTCATGCAAGGCCACGAGGTCGACAACTCGGCGCTGAATCTG
CTGGATAAGACGGACAAGGAGCTGCCGACGTTTCGATATGTGTATTAG
Gene >Ophun1|3696
ATGATGGGCCATCTCCAGCCCATTCACCGGCCCGCGCCCGCCCCGGAAGTCAAGGTCGGGGCTTCGCCGTCCGAG
TCCATCTCGGCAGAGGATCATGGACGGCTCCTCCGCCGGATCGATCTTTGGTGCTTCACCCTCTCCCAGTCAGAG
CCTACAGAGTGAAAAAAGAACGAGGTAGCTAAAGCAAAAGGACATCATGGTTCATTCATCCCTTGTCTTTTCAGT
CTCCTGCCCGTCATGGCCATCAGCTACATGTTCCAATTCCTAGACAAGACGGCCCTCGGCTTCACCGCCATCTTG
GGCCTCCCGCAAGCCCTCCATCTCAGCGGCCTCGCCTTCTCCTGGGCCTCGGGCGTCTACTATGCCGGCTACCTC
ATCGCCACCTATCCGGCCGGCATCATCATGGTAAAGTGGAAAGTCGGCAAGACAATTGCCTGCTCCGCGTGAGTC
CCCCCGTCTTTCATCTATTTCGACGTTGACCAACCAGCTGATCCGCTCACCACCCATCTGAAGCGCCCTTTGGGG
CATAACCTTGATGCTCACCGCCGTCGTCTCAAACGCCGCCGGCCTCATAGCAGTCCGCTTCTTCCTCGGCGTATT
CGAAGCCCCCATCGCACCGGGCCTCACCGTCATAGTATCAATGTGGTTCAAGCGGAACGAGCAGCCCCTTCGTCA
AACAGCCTGGTTTCTCGGAAACACCACCGCCGGCATCGTCGGCGCGCTGGTGGCCTATGCCATCGGCCACATACA
AGGCATCGCCACCTGGAAGGTGAAGCTCTTCGGCCGCTATACCCAGATTGTCACGCTCAACTTTTGTAGGCCGTC
TTCATCATCTTTGGCGCCTTTACGACTGCCTGGTCTGTTGGCCTCTTCTGGCTCCTCCCCGACGTCCCCATGACA
GCCTGGTTTCTGTCTCCGCCCGACCGAGTCAAGGCCGTAGCCCGGGTAAAGGACAACATGACGGGCATCAAAAAC
GATGAATTCAAGTGGCGACAGTTCCGCGAAGCCATCCTCGACATCAACGCATGGAGCATCGTCCTCATCACAATG
ACCATGAACATGTCCAACGGCGGTCTCCTCAGCGTCTGTAGCCCGGAGCTCAAGTGAAGCGCTGAAGCTGACGAC
GAGGATAGTTCAATTCCATCGTGCTCGAGGGCCTCGGCTTCGATCGCTTGAAGACGCTACTCCTACAGAGCGCAA
CCTATCTCTTTCAGCTCTTCCTCGTCCTCGTCTGCGCGACCATGAGCAGCCGGCTGAAGAACAAGCGACTGCTGC
TGATGGTGCTGAACTTCTTGTTGTCCATCATCGGCTGCGCCCTCGTCCGCCAACTTCCAGCCCACCTCAAGTGGC
CTCGCTACGTCGGATACATCCTCACCATTGCCTTCAGCGCAAACTACCCACTCATCCTATCCGTCGTATCAGCCA
ACGTCAGCGGTTTCACCAAGAAGGTAACCGTCACCAGCATGGTAAGTGTCCCTTGCCTATCCGTACATCCCGATG
CCAAACAGAAGCAGGTCGTCATGTCCTACTGCGCCGGCAACATCATCGGCCCGCAGTTCTTCATCGAAGCCGAGG
CGCCCTCCTACAACTCAGCCTTCCTAGCCGTCATGATGTGCTTCGGCATCTCCGCCGTGCTGTGTCTCGTGCTGC
GCTTCTCGCTCTCGCGGCAGAACCGAGCTCGAGATCAGGTGCAGGTCATGCAAGGCCACGAGGTCGACAACTCGG
CGCTGAATCTGCTGGATAAGACGGACAAGGAGCTGCCGACGTTTCGATATGTGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail