Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3693
Gene name
LocationContig_33:38242..39298
Strand-
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 5.9E-14 116 194

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A4E3|OCH1_CANAL Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCH1 PE=3 SV=1 1 351 3.0E-92
sp|Q9UTR6|OCH1_SCHPO Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=och1 PE=1 SV=2 79 351 6.0E-76
sp|P47124|HOC1_YEAST Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOC1 PE=1 SV=3 75 347 4.0E-70
sp|P31755|OCH1_YEAST Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCH1 PE=1 SV=1 75 351 1.0E-63

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.898774

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 9.2E-20 116 194

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|958
Ophiocordyceps australis map64 (Brazil) OphauB2|6430
Ophiocordyceps camponoti-floridani Ophcf2|03842
Ophiocordyceps camponoti-rufipedis Ophun1|3693 (this protein)
Ophiocordyceps kimflemingae Ophio5|7659
Ophiocordyceps subramaniannii Hirsu2|4247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3693
MLNSRRALAAAAAIVTFFFLLSRDHQATPVAAASDRPPSSDSDLGSDPGSASPWSGSSVSRHKLQQPMMDTSRLT
VQEKLAYAYPYDRAAKFPAYIWQTWKKTPADEGFEFGEQEATWTTQHPGFVHEVLSDDTADSLLSLLYASVPEVL
EAYRALPLPILKADFFRYLILLARGGIYSDIDTYALKSAVDWIPDSIPRDTFGLVVGIEADPDRPDWADWYSRRI
QFCQWTIQSKPGHPVLRDVVARITNRTLTVKRESGFSAFSGTKVIEFTGPALWTDVLMDYFNDDRYFHTRDSRAP
IDWHSFTGMQTIKRVGDVIVLPITSFSPGVEQMGSKDVDDPMAFVKHDFEG*
Coding >Ophun1|3693
ATGCTCAACTCGCGCCGCGCCCTGGCCGCCGCCGCCGCTATCGTCACCTTCTTCTTCCTCCTCTCGCGCGATCAC
CAGGCGACGCCCGTCGCGGCCGCCAGCGACCGTCCGCCCTCGTCCGACTCCGACCTCGGCTCCGACCCCGGCTCC
GCTTCTCCTTGGTCCGGTAGCTCCGTCAGCCGACACAAGCTCCAGCAGCCGATGATGGACACATCACGGCTGACG
GTGCAGGAGAAACTCGCTTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATCTGGCAGACGTGG
AAGAAGACGCCGGCGGACGAGGGCTTCGAGTTTGGCGAACAAGAGGCCACGTGGACGACTCAACACCCGGGCTTC
GTCCACGAGGTCCTCTCCGACGACACGGCCGATAGCCTCCTCAGCCTGCTGTACGCGTCGGTGCCCGAGGTGCTC
GAGGCCTACCGCGCCCTGCCGCTGCCCATCCTCAAGGCAGACTTCTTCCGCTACCTCATCCTGCTGGCCCGCGGC
GGCATCTACTCCGACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGAC
ACCTTTGGCCTCGTCGTCGGCATCGAAGCAGACCCGGATCGCCCGGACTGGGCAGACTGGTACAGCCGCCGCATC
CAGTTCTGCCAGTGGACCATCCAGAGCAAGCCCGGCCATCCCGTCCTGCGCGACGTCGTCGCCCGCATCACCAAC
CGTACCCTCACCGTCAAGCGCGAGAGCGGCTTCTCCGCCTTTTCCGGCACCAAGGTCATCGAGTTCACCGGCCCG
GCCCTGTGGACCGACGTGCTGATGGACTACTTCAATGACGACCGCTACTTCCACACCCGCGACAGCAGGGCGCCC
ATCGACTGGCATAGCTTCACCGGCATGCAGACCATCAAGCGCGTCGGCGACGTCATCGTCCTTCCCATCACCAGC
TTCTCGCCCGGTGTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCGATGGCCTTTGTCAAGCATGACTTTGAG
GGTTAG
Transcript >Ophun1|3693
ATGCTCAACTCGCGCCGCGCCCTGGCCGCCGCCGCCGCTATCGTCACCTTCTTCTTCCTCCTCTCGCGCGATCAC
CAGGCGACGCCCGTCGCGGCCGCCAGCGACCGTCCGCCCTCGTCCGACTCCGACCTCGGCTCCGACCCCGGCTCC
GCTTCTCCTTGGTCCGGTAGCTCCGTCAGCCGACACAAGCTCCAGCAGCCGATGATGGACACATCACGGCTGACG
GTGCAGGAGAAACTCGCTTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATCTGGCAGACGTGG
AAGAAGACGCCGGCGGACGAGGGCTTCGAGTTTGGCGAACAAGAGGCCACGTGGACGACTCAACACCCGGGCTTC
GTCCACGAGGTCCTCTCCGACGACACGGCCGATAGCCTCCTCAGCCTGCTGTACGCGTCGGTGCCCGAGGTGCTC
GAGGCCTACCGCGCCCTGCCGCTGCCCATCCTCAAGGCAGACTTCTTCCGCTACCTCATCCTGCTGGCCCGCGGC
GGCATCTACTCCGACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGAC
ACCTTTGGCCTCGTCGTCGGCATCGAAGCAGACCCGGATCGCCCGGACTGGGCAGACTGGTACAGCCGCCGCATC
CAGTTCTGCCAGTGGACCATCCAGAGCAAGCCCGGCCATCCCGTCCTGCGCGACGTCGTCGCCCGCATCACCAAC
CGTACCCTCACCGTCAAGCGCGAGAGCGGCTTCTCCGCCTTTTCCGGCACCAAGGTCATCGAGTTCACCGGCCCG
GCCCTGTGGACCGACGTGCTGATGGACTACTTCAATGACGACCGCTACTTCCACACCCGCGACAGCAGGGCGCCC
ATCGACTGGCATAGCTTCACCGGCATGCAGACCATCAAGCGCGTCGGCGACGTCATCGTCCTTCCCATCACCAGC
TTCTCGCCCGGTGTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCGATGGCCTTTGTCAAGCATGACTTTGAG
GGTTAG
Gene >Ophun1|3693
ATGCTCAACTCGCGCCGCGCCCTGGCCGCCGCCGCCGCTATCGTCACCTTCTTCTTCCTCCTCTCGCGCGATCAC
CAGGCGACGCCCGTCGCGGCCGCCAGCGACCGTCCGCCCTCGTCCGACTCCGACCTCGGCTCCGACCCCGGCTCC
GCTTCTCCTTGGTCCGGTAGCTCCGTCAGCCGACACAAGCTCCAGCAGCCGATGATGGACACATCACGGCTGACG
GTGCAGGAGAAACTCGCTTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATCTGGCAGACGTGG
AAGAAGACGCCGGCGGACGAGGGCTTCGAGTTTGGCGAACAAGAGGCCACGTGGACGACTCAACACCCGGGCTTC
GTCCACGAGGTCCTCTCCGACGACACGGCCGATAGCCTCCTCAGCCTGCTGTACGCGTCGGTGCCCGAGGTGCTC
GAGGCCTACCGCGCCCTGCCGCTGCCCATCCTCAAGGCAGACTTCTTCCGCTACCTCATCCTGCTGGCCCGCGGC
GGCATCTACTCCGACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGAC
ACCTTTGGCCTCGTCGTCGGCATCGAAGCAGACCCGGATCGCCCGGACTGGGCAGACTGGTACAGCCGCCGCATC
CAGTTCTGCCAGTGGACCATCCAGAGCAAGCCCGGCCATCCCGTCCTGCGCGACGTCGTCGCCCGCATCACCAAC
CGTACCCTCACCGTCAAGCGCGAGAGCGGCTTCTCCGCCTTTTCCGGCACCAAGGTCATCGAGTTCACCGGCCCG
GCCCTGTGGACCGACGTGCTGATGGACTACTTCAATGACGACCGCTACTTCCACACCCGCGACAGCAGGGCGCCC
ATCGACTGGCATAGCTTCACCGGCATGCAGACCATCAAGCGCGTCGGCGACGTCATCGTCCTTCCCATCACCAGC
TTCTCGCCCGGTGTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCGATGGCCTTTGTCAAGCATGACTTTGAG
GGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail