Protein ID | Ophun1|3692 |
Gene name | |
Location | Contig_33:35569..37505 |
Strand | - |
Gene length (bp) | 1936 |
Transcript length (bp) | 1878 |
Coding sequence length (bp) | 1878 |
Protein length (aa) | 626 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00501 | AMP-binding | AMP-binding enzyme | 2.6E-81 | 37 | 521 |
PF13193 | AMP-binding_C | AMP-binding enzyme C-terminal domain | 5.4E-18 | 530 | 605 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O31826|YNGI_BACSU | Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 | 23 | 616 | 5.0E-104 |
sp|Q0P4F7|ACSF2_DANRE | Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 | 10 | 619 | 4.0E-79 |
sp|Q8VCW8|ACSF2_MOUSE | Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 | 259 | 620 | 2.0E-75 |
sp|Q499N5|ACSF2_RAT | Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 | 259 | 620 | 4.0E-75 |
sp|Q96CM8|ACSF2_HUMAN | Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 | 259 | 614 | 7.0E-75 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O31826|YNGI_BACSU | Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 | 23 | 616 | 5.0E-104 |
sp|Q0P4F7|ACSF2_DANRE | Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 | 10 | 619 | 4.0E-79 |
sp|Q8VCW8|ACSF2_MOUSE | Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 | 259 | 620 | 2.0E-75 |
sp|Q499N5|ACSF2_RAT | Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 | 259 | 620 | 4.0E-75 |
sp|Q96CM8|ACSF2_HUMAN | Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 | 259 | 614 | 7.0E-75 |
sp|Q4R4Z9|ACSF2_MACFA | Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 | 8 | 614 | 4.0E-73 |
sp|Q5R9G9|ACSF2_PONAB | Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 | 13 | 614 | 2.0E-72 |
sp|Q17QJ1|ACSF2_BOVIN | Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 | 252 | 614 | 1.0E-68 |
sp|Q7WSH3|FADD3_COMTE | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 | 28 | 611 | 8.0E-58 |
sp|O07610|LCFB_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 | 254 | 613 | 5.0E-51 |
sp|P69451|LCFA_ECOLI | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 | 37 | 622 | 5.0E-48 |
sp|P69452|LCFA_ECOL6 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 | 37 | 622 | 5.0E-48 |
sp|Q0S7V5|FAD3_RHOJR | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 | 252 | 614 | 2.0E-47 |
sp|Q8XDR6|LCFA_ECO57 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 | 37 | 622 | 1.0E-46 |
sp|P63521|LCFA_SALTY | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 | 61 | 622 | 1.0E-45 |
sp|P63522|LCFA_SALTI | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 | 61 | 622 | 1.0E-45 |
sp|P96843|FAD3_MYCTU | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 | 254 | 613 | 2.0E-44 |
sp|P38135|FADK_ECOLI | Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 | 256 | 619 | 2.0E-43 |
sp|Q0K844|SAUT_CUPNH | Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 | 260 | 615 | 2.0E-42 |
sp|P96575|YDAB_BACSU | Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 | 214 | 616 | 9.0E-42 |
sp|P94547|LCFA_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 | 78 | 614 | 1.0E-41 |
sp|P46450|LCFA_HAEIN | Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 | 37 | 618 | 3.0E-41 |
sp|Q8ZES9|LCFA_YERPE | Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 | 39 | 616 | 6.0E-38 |
sp|Q9LPK7|AEE10_ARATH | Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 | 72 | 615 | 3.0E-35 |
sp|F4HUK6|AAE1_ARATH | Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 | 247 | 624 | 8.0E-35 |
sp|O80658|AAE4_ARATH | Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 | 260 | 615 | 2.0E-33 |
sp|Q9SEY5|AAE2_ARATH | Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 | 244 | 615 | 2.0E-33 |
sp|Q54P77|4CL1_DICDI | Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 | 79 | 613 | 4.0E-33 |
sp|O74976|FAT2_SCHPO | Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 | 253 | 608 | 2.0E-32 |
sp|Q54P79|4CL3_DICDI | Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 | 79 | 619 | 3.0E-32 |
sp|P38137|FAT2_YEAST | Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 | 246 | 618 | 3.0E-32 |
sp|Q00594|ALKK_PSEOL | Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 | 249 | 614 | 4.0E-32 |
sp|Q9C8D4|AAE11_ARATH | Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 | 59 | 617 | 6.0E-32 |
sp|Q9LPK6|AEE9_ARATH | Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 | 260 | 615 | 2.0E-31 |
sp|Q7XXL2|4CLL9_ORYSJ | 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 | 255 | 622 | 4.0E-31 |
sp|Q9SS01|AAE20_ARATH | Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 | 259 | 615 | 6.0E-31 |
sp|Q5SKN9|LCFCS_THET8 | Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 | 259 | 614 | 1.0E-30 |
sp|Q9FFE9|AAE6_ARATH | Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 | 260 | 615 | 3.0E-30 |
sp|Q9FFE6|AAE5_ARATH | Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 | 248 | 615 | 3.0E-30 |
sp|Q5LRT0|DMDB_RUEPO | 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 | 78 | 614 | 4.0E-30 |
sp|Q9SS00|AAE12_ARATH | Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 | 260 | 615 | 3.0E-29 |
sp|Q54P78|4CL2_DICDI | Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 | 83 | 613 | 6.0E-29 |
sp|P86832|CBCL2_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 | 260 | 613 | 9.0E-29 |
sp|P86831|CBCL1_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 | 260 | 613 | 9.0E-29 |
sp|Q9S725|4CL2_ARATH | 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 | 29 | 621 | 2.0E-28 |
sp|B9J2F2|MENE_BACCQ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 | 252 | 613 | 3.0E-28 |
sp|Q9CHK3|MENE_LACLA | 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 | 220 | 612 | 5.0E-28 |
sp|B7HTW3|MENE_BACC7 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 | 233 | 613 | 5.0E-28 |
sp|B7JDD6|MENE_BACC0 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 | 233 | 613 | 5.0E-28 |
sp|Q632I5|MENE_BACCZ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 | 233 | 613 | 5.0E-28 |
sp|Q6HC29|MENE_BACHK | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 | 233 | 613 | 7.0E-28 |
sp|A0RK73|MENE_BACAH | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 | 233 | 613 | 8.0E-28 |
sp|Q81K97|MENE_BACAN | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 | 233 | 613 | 1.0E-27 |
sp|C3LB87|MENE_BACAC | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 | 233 | 613 | 1.0E-27 |
sp|C3PCK3|MENE_BACAA | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 | 233 | 613 | 1.0E-27 |
sp|Q816I1|MENE_BACCR | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 | 233 | 613 | 2.0E-27 |
sp|P9WQ37|FAC13_MYCTU | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 | 244 | 614 | 2.0E-27 |
sp|P9WQ36|FAC13_MYCTO | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 | 244 | 614 | 2.0E-27 |
sp|Q72YK9|MENE_BACC1 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 | 233 | 613 | 2.0E-27 |
sp|Q8GQN9|BCLA_THAAR | Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 | 251 | 612 | 2.0E-27 |
sp|A9VM74|MENE_BACWK | 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 | 252 | 612 | 3.0E-27 |
sp|Q10S72|4CLL4_ORYSJ | 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 | 259 | 619 | 3.0E-27 |
sp|O07619|YHFT_BACSU | Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 | 249 | 620 | 3.0E-27 |
sp|Q9SFW5|AEE21_ARATH | Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 | 216 | 615 | 3.0E-27 |
sp|Q8ENZ7|MENE_OCEIH | 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 | 213 | 611 | 3.0E-27 |
sp|O24145|4CL1_TOBAC | 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 | 252 | 621 | 1.0E-26 |
sp|Q8VZF1|AEE7_ARATH | Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 | 239 | 615 | 2.0E-26 |
sp|Q9LU36|4CL4_ARATH | 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 | 62 | 620 | 2.0E-26 |
sp|Q9SMT7|4CLLA_ARATH | Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 | 263 | 608 | 3.0E-26 |
sp|B4EY25|CAIC_PROMH | Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 | 251 | 612 | 4.0E-26 |
sp|Q8VYJ1|MENE_ARATH | 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 | 200 | 620 | 5.0E-26 |
sp|A8FGK6|MENE_BACP2 | 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 | 260 | 615 | 6.0E-26 |
sp|C5D6U5|MENE_GEOSW | 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 | 257 | 613 | 6.0E-26 |
sp|Q27757|LUCI_PHOPE | Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 | 42 | 613 | 6.0E-26 |
sp|Q01158|LUCI_LUCLA | Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 | 260 | 619 | 6.0E-26 |
sp|A9MQH7|CAIC_SALAR | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 | 250 | 612 | 8.0E-26 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 262 | 608 | 8.0E-26 |
sp|O24146|4CL2_TOBAC | 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 | 252 | 621 | 1.0E-25 |
sp|Q67W82|4CL4_ORYSJ | Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 | 29 | 625 | 1.0E-25 |
sp|Q0DV32|4CLL1_ORYSJ | 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 | 247 | 623 | 1.0E-25 |
sp|P58730|MENE_LISMO | 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 | 57 | 613 | 1.0E-25 |
sp|Q26304|LUCI_LUCMI | Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 | 246 | 613 | 1.0E-25 |
sp|Q8GB18|CAIC_PROSL | Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 | 251 | 612 | 1.0E-25 |
sp|Q9AJS8|3HBCL_THAAR | 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 | 252 | 619 | 2.0E-25 |
sp|Q9LQS1|AAE8_ARATH | Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 | 248 | 615 | 2.0E-25 |
sp|P23971|MENE_BACSU | 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 | 260 | 613 | 2.0E-25 |
sp|Q65FT5|MENE_BACLD | 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 | 245 | 611 | 3.0E-25 |
sp|P31684|4CL1_SOLTU | 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 | 252 | 621 | 5.0E-25 |
sp|A7GU88|MENE_BACCN | 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 | 233 | 605 | 5.0E-25 |
sp|P13129|LUCI_LUCCR | Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 | 260 | 619 | 5.0E-25 |
sp|Q68CK6|ACS2B_HUMAN | Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 | 260 | 614 | 8.0E-25 |
sp|B5R1R0|CAIC_SALEP | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 | 40 | 612 | 8.0E-25 |
sp|Q08AH3|ACS2A_HUMAN | Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 | 260 | 614 | 8.0E-25 |
sp|Q6ZAC1|4CL5_ORYSJ | Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 | 262 | 619 | 9.0E-25 |
sp|B5F750|CAIC_SALA4 | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 | 40 | 612 | 1.0E-24 |
sp|Q5KVX9|MENE_GEOKA | 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 | 255 | 612 | 1.0E-24 |
sp|Q42524|4CL1_ARATH | 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 | 29 | 621 | 1.0E-24 |
sp|Q838K1|MENE_ENTFA | 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 | 251 | 614 | 1.0E-24 |
sp|Q84P25|4CLL2_ARATH | 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 | 262 | 619 | 1.0E-24 |
sp|Q3URE1|ACSF3_MOUSE | Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 | 260 | 623 | 1.0E-24 |
sp|B5BL55|CAIC_SALPK | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 | 40 | 612 | 1.0E-24 |
sp|Q5PIL0|CAIC_SALPA | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 | 40 | 612 | 1.0E-24 |
sp|Q7TN78|ACSM4_RAT | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 | 35 | 618 | 2.0E-24 |
sp|Q42982|4CL2_ORYSJ | Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 | 29 | 612 | 2.0E-24 |
sp|Q8Z9L4|CAIC_SALTI | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 | 40 | 612 | 3.0E-24 |
sp|B4TWR4|CAIC_SALSV | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 | 40 | 612 | 3.0E-24 |
sp|P31685|4CL2_SOLTU | 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 | 252 | 621 | 3.0E-24 |
sp|P40871|DHBE_BACSU | 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 | 244 | 619 | 3.0E-24 |
sp|A7Z809|MENE_BACMF | 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 | 214 | 613 | 4.0E-24 |
sp|Q80W40|ACSM4_MOUSE | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 | 35 | 618 | 5.0E-24 |
sp|Q8ZRX4|CAIC_SALTY | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 | 40 | 612 | 6.0E-24 |
sp|B4TIH0|CAIC_SALHS | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 | 40 | 612 | 6.0E-24 |
sp|B4T6J6|CAIC_SALNS | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 | 40 | 612 | 7.0E-24 |
sp|B5FHG5|CAIC_SALDC | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 | 40 | 612 | 9.0E-24 |
sp|Q8RU95|4CLL6_ORYSJ | 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 | 256 | 617 | 1.0E-23 |
sp|Q6ETN3|4CL3_ORYSJ | Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 | 252 | 612 | 1.0E-23 |
sp|Q53005|4HBCL_RHOPA | 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 | 257 | 625 | 2.0E-23 |
sp|Q71YZ5|MENE_LISMF | 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 | 234 | 613 | 3.0E-23 |
sp|Q69RG7|4CLL7_ORYSJ | 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 | 62 | 625 | 3.0E-23 |
sp|Q4G176|ACSF3_HUMAN | Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 | 260 | 611 | 4.0E-23 |
sp|P17814|4CL1_ORYSJ | Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 | 17 | 625 | 6.0E-23 |
sp|B7MNP4|CAIC_ECO81 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 | 64 | 612 | 8.0E-23 |
sp|P39062|ACSA_BACSU | Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 | 58 | 612 | 9.0E-23 |
sp|B7UI83|CAIC_ECO27 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 | 222 | 612 | 9.0E-23 |
sp|A8ALR6|CAIC_CITK8 | Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 | 208 | 612 | 1.0E-22 |
sp|Q57TJ0|CAIC_SALCH | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 | 40 | 612 | 1.0E-22 |
sp|Q92AY8|MENE_LISIN | 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 | 255 | 613 | 1.0E-22 |
sp|Q84P23|4CLL9_ARATH | 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 | 260 | 616 | 2.0E-22 |
sp|P08659|LUCI_PHOPY | Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 | 28 | 613 | 2.0E-22 |
sp|Q84P24|4CLL6_ARATH | 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 | 250 | 625 | 2.0E-22 |
sp|C0Q4L3|CAIC_SALPC | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 | 40 | 612 | 4.0E-22 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 250 | 608 | 5.0E-22 |
sp|Q5REV5|ACSM3_PONAB | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 | 52 | 614 | 5.0E-22 |
sp|Q6GLK6|ACSF3_XENLA | Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 | 260 | 611 | 6.0E-22 |
sp|Q9L9F6|NOVL_STRNV | 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 | 214 | 613 | 6.0E-22 |
sp|A6TDH2|AAS_KLEP7 | Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 | 253 | 605 | 8.0E-22 |
sp|Q8K0L3|ACSM2_MOUSE | Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 | 260 | 612 | 9.0E-22 |
sp|Q7F1X5|4CLL5_ORYSJ | 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 | 255 | 617 | 1.0E-21 |
sp|B5XUP2|AAS_KLEP3 | Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-21 |
sp|Q9M0X9|4CLL7_ARATH | 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 | 61 | 619 | 1.0E-21 |
sp|Q5HRH4|VRAA_STAEQ | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraA PE=3 SV=1 | 254 | 616 | 1.0E-21 |
sp|P14912|4CL1_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 | 61 | 612 | 1.0E-21 |
sp|O70490|ACSM2_RAT | Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 | 260 | 612 | 2.0E-21 |
sp|A7ZHC8|CAIC_ECO24 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 | 222 | 612 | 2.0E-21 |
sp|Q58DN7|ACSF3_BOVIN | Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 | 260 | 611 | 2.0E-21 |
sp|Q7TYQ4|MBTB_MYCBO | Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 | 251 | 622 | 2.0E-21 |
sp|P9WQ63|MBTB_MYCTU | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 | 251 | 622 | 3.0E-21 |
sp|P9WQ62|MBTB_MYCTO | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 | 251 | 622 | 3.0E-21 |
sp|Q3Z5X2|CAIC_SHISS | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 | 222 | 612 | 3.0E-21 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 255 | 623 | 3.0E-21 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 255 | 611 | 4.0E-21 |
sp|Q53FZ2|ACSM3_HUMAN | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 | 255 | 614 | 4.0E-21 |
sp|P14913|4CL2_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 | 61 | 612 | 4.0E-21 |
sp|Q6SKG1|ACSM3_RAT | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 | 260 | 612 | 4.0E-21 |
sp|B7M0D4|CAIC_ECO8A | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 | 222 | 612 | 4.0E-21 |
sp|Q3UNX5|ACSM3_MOUSE | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 | 260 | 614 | 5.0E-21 |
sp|Q84P26|4CLL8_ARATH | 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 | 262 | 619 | 5.0E-21 |
sp|B7MAG0|CAIC_ECO45 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 | 231 | 612 | 6.0E-21 |
sp|A7ZVY7|CAIC_ECOHS | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 | 222 | 612 | 6.0E-21 |
sp|Q83MG9|CAIC_SHIFL | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 | 222 | 612 | 7.0E-21 |
sp|Q8H151|AAE13_ARATH | Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 | 260 | 623 | 7.0E-21 |
sp|P59872|ACSA_RHOBA | Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 | 27 | 618 | 8.0E-21 |
sp|Q84HC5|NCSB2_STRCZ | 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 | 255 | 615 | 9.0E-21 |
sp|O24540|4CL_VANPL | 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 | 252 | 606 | 1.0E-20 |
sp|Q3YY21|AAS_SHISS | Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B6I6W1|AAS_ECOSE | Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B7LF13|AAS_ECO55 | Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B2TYQ5|AAS_SHIB3 | Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B1IRD9|CAIC_ECOLC | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 | 222 | 612 | 1.0E-20 |
sp|B5YYD1|CAIC_ECO5E | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 | 222 | 612 | 1.0E-20 |
sp|Q8XA34|CAIC_ECO57 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 | 222 | 612 | 1.0E-20 |
sp|B1IU08|AAS_ECOLC | Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|A8A3X0|AAS_ECOHS | Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|A7ZQU2|AAS_ECO24 | Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|P41636|4CL_PINTA | 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 | 252 | 618 | 1.0E-20 |
sp|P31119|AAS_ECOLI | Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 | 253 | 605 | 1.0E-20 |
sp|B1XDP2|AAS_ECODH | Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|C4ZZY9|AAS_ECOBW | Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B7N768|AAS_ECOLU | Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 250 | 608 | 1.0E-20 |
sp|P0C5B6|4CLL4_ARATH | 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 | 262 | 619 | 1.0E-20 |
sp|O07899|VIBE_VIBCH | Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 | 254 | 612 | 1.0E-20 |
sp|P80436|TRS1_STRTI | Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 | 386 | 617 | 1.0E-20 |
sp|B1LR34|AAS_ECOSM | Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B5Z4F4|AAS_ECO5E | Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|Q8X6J8|AAS_ECO57 | Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|Q1R7H5|AAS_ECOUT | Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|A1AF47|AAS_ECOK1 | Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B7MLI2|AAS_ECO45 | Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|Q8FEA6|AAS_ECOL6 | Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|B7UHQ4|AAS_ECO27 | Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-20 |
sp|Q9C9G2|AEE22_ARATH | Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 | 260 | 612 | 2.0E-20 |
sp|Q1RGG1|CAIC_ECOUT | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 | 231 | 612 | 2.0E-20 |
sp|A1A787|CAIC_ECOK1 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 | 231 | 612 | 2.0E-20 |
sp|B7NVY2|AAS_ECO7I | Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 | 253 | 605 | 2.0E-20 |
sp|Q83JV7|AAS_SHIFL | Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 | 253 | 605 | 2.0E-20 |
sp|Q0T128|AAS_SHIF8 | Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 | 253 | 605 | 2.0E-20 |
sp|B7L4G0|CAIC_ECO55 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 | 222 | 612 | 2.0E-20 |
sp|Q9KV59|ACSA_VIBCH | Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 | 27 | 621 | 3.0E-20 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 255 | 623 | 3.0E-20 |
sp|P31687|4CL2_SOYBN | 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 | 241 | 622 | 3.0E-20 |
sp|Q7A1Q0|VRAA_STAAW | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MW2) GN=vraA PE=3 SV=1 | 256 | 611 | 4.0E-20 |
sp|Q6GBR2|VRAA_STAAS | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MSSA476) GN=vraA PE=3 SV=1 | 256 | 611 | 4.0E-20 |
sp|Q7A769|VRAA_STAAN | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain N315) GN=vraA PE=3 SV=1 | 256 | 611 | 4.0E-20 |
sp|Q99W34|VRAA_STAAM | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraA PE=3 SV=1 | 256 | 611 | 4.0E-20 |
sp|Q5HIA1|VRAA_STAAC | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain COL) GN=vraA PE=3 SV=1 | 256 | 611 | 4.0E-20 |
sp|Q9KWK5|VRAA_STAA1 | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraA PE=3 SV=3 | 256 | 611 | 4.0E-20 |
sp|B6HYY8|CAIC_ECOSE | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 | 222 | 612 | 4.0E-20 |
sp|Q3E6Y4|4CLL3_ARATH | 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 | 262 | 619 | 4.0E-20 |
sp|Q0TDZ6|AAS_ECOL5 | Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 | 253 | 605 | 5.0E-20 |
sp|P0DJH0|ANGR_VIBAN | Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 | 246 | 624 | 5.0E-20 |
sp|Q6W4T3|ANGR_VIBA7 | Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 | 246 | 624 | 5.0E-20 |
sp|Q6GFR0|MENE_STAAR | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 | 250 | 611 | 6.0E-20 |
sp|Q9S777|4CL3_ARATH | 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 | 262 | 619 | 6.0E-20 |
sp|B7NHE1|CAIC_ECO7I | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 | 222 | 612 | 6.0E-20 |
sp|B1LFX0|CAIC_ECOSM | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 | 222 | 612 | 7.0E-20 |
sp|A9MYJ6|CAIC_SALPB | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 | 250 | 612 | 7.0E-20 |
sp|Q84P21|4CLL5_ARATH | 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 | 262 | 606 | 8.0E-20 |
sp|P31552|CAIC_ECOLI | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 | 222 | 612 | 9.0E-20 |
sp|B1XBG2|CAIC_ECODH | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 | 222 | 612 | 9.0E-20 |
sp|C4ZPW3|CAIC_ECOBW | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 | 222 | 612 | 9.0E-20 |
sp|B7LWM8|CAIC_ESCF3 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 | 222 | 612 | 1.0E-19 |
sp|B7LNJ2|AAS_ESCF3 | Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-19 |
sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 251 | 608 | 1.0E-19 |
sp|Q6AYT9|ACSM5_RAT | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 | 260 | 618 | 1.0E-19 |
sp|Q9LQ12|4CLL1_ARATH | 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 | 262 | 617 | 2.0E-19 |
sp|Q8FLA5|CAIC_ECOL6 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 | 231 | 612 | 2.0E-19 |
sp|Q0TLV2|CAIC_ECOL5 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 | 231 | 612 | 2.0E-19 |
sp|Q6D107|AAS_PECAS | Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 | 251 | 625 | 2.0E-19 |
sp|Q6NUN0|ACSM5_HUMAN | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 | 260 | 618 | 2.0E-19 |
sp|A8AN29|ACSA_CITK8 | Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 | 23 | 621 | 2.0E-19 |
sp|Q6GJ94|VRAA_STAAR | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MRSA252) GN=vraA PE=3 SV=1 | 256 | 611 | 2.0E-19 |
sp|A4TS06|ACSA_YERPP | Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 | 23 | 621 | 3.0E-19 |
sp|Q1CE37|ACSA_YERPN | Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 | 23 | 621 | 3.0E-19 |
sp|Q8D1G8|ACSA_YERPE | Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 | 23 | 621 | 3.0E-19 |
sp|Q1C0N0|ACSA_YERPA | Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 | 23 | 621 | 3.0E-19 |
sp|Q8Z406|AAS_SALTI | Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 | 253 | 623 | 3.0E-19 |
sp|P63526|MENE_STAAN | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 | 250 | 611 | 3.0E-19 |
sp|P63525|MENE_STAAM | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-19 |
sp|A5ITW2|MENE_STAA9 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-19 |
sp|A6U2Q7|MENE_STAA2 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-19 |
sp|A7X3P0|MENE_STAA1 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-19 |
sp|Q66FM8|ACSA_YERPS | Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 | 23 | 621 | 3.0E-19 |
sp|A7FNG1|ACSA_YERP3 | Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 | 23 | 621 | 3.0E-19 |
sp|C6DE43|AAS_PECCP | Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 | 251 | 625 | 3.0E-19 |
sp|P0C7M7|ACSM4_HUMAN | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 | 54 | 614 | 3.0E-19 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 253 | 608 | 4.0E-19 |
sp|C0PXJ8|AAS_SALPC | Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|Q57KA7|AAS_SALCH | Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|B5F4V4|AAS_SALA4 | Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|B4TUM9|AAS_SALSV | Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|Q6LLZ1|ACSA_PHOPR | Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 | 27 | 612 | 4.0E-19 |
sp|B4TGR5|AAS_SALHS | Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|B5QWU2|AAS_SALEP | Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|B5RDY6|AAS_SALG2 | Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 | 253 | 623 | 4.0E-19 |
sp|Q8NVZ4|MENE_STAAW | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 | 250 | 611 | 5.0E-19 |
sp|Q6G8D6|MENE_STAAS | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 | 250 | 611 | 5.0E-19 |
sp|B5BFH6|AAS_SALPK | Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 | 253 | 623 | 5.0E-19 |
sp|Q5PEN7|AAS_SALPA | Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 | 253 | 623 | 5.0E-19 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 215 | 608 | 5.0E-19 |
sp|A9N3H8|AAS_SALPB | Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 | 253 | 623 | 5.0E-19 |
sp|B5FUB9|AAS_SALDC | Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 | 253 | 623 | 5.0E-19 |
sp|A1JIK3|ACSA_YERE8 | Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 | 23 | 621 | 6.0E-19 |
sp|Q8CQ67|VRAA_STAES | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraA PE=3 SV=1 | 254 | 556 | 6.0E-19 |
sp|Q8ZMA4|AAS_SALTY | Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 | 253 | 623 | 6.0E-19 |
sp|Q2YTP0|MENE_STAAB | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 | 250 | 611 | 7.0E-19 |
sp|B4T503|AAS_SALNS | Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 | 253 | 623 | 7.0E-19 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 217 | 611 | 8.0E-19 |
sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 252 | 608 | 9.0E-19 |
sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 241 | 612 | 1.0E-18 |
sp|B7N7R2|CAIC_ECOLU | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 | 231 | 612 | 1.0E-18 |
sp|B1JQC1|AAS_YERPY | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 | 260 | 538 | 1.0E-18 |
sp|Q667F1|AAS_YERPS | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 | 260 | 538 | 1.0E-18 |
sp|B2JZ75|AAS_YERPB | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 | 260 | 538 | 1.0E-18 |
sp|A7FFD1|AAS_YERP3 | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 | 260 | 538 | 1.0E-18 |
sp|A4TLD3|AAS_YERPP | Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 | 260 | 533 | 1.0E-18 |
sp|A9R2S1|AAS_YERPG | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 | 260 | 533 | 1.0E-18 |
sp|Q0T8F7|CAIC_SHIF8 | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 | 222 | 562 | 1.0E-18 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 254 | 608 | 1.0E-18 |
sp|Q74RZ6|AAS_YERPE | Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 | 260 | 533 | 1.0E-18 |
sp|Q1CAS8|AAS_YERPA | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 | 260 | 533 | 1.0E-18 |
sp|Q6YYZ2|4CLL3_ORYSJ | 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 | 260 | 613 | 1.0E-18 |
sp|O53551|FAC17_MYCTU | Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 | 262 | 617 | 2.0E-18 |
sp|Q7TWC5|FAC17_MYCBO | Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 | 262 | 617 | 2.0E-18 |
sp|B2HIM0|FAA28_MYCMM | Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 | 260 | 619 | 2.0E-18 |
sp|Q4L3Q0|VRAA_STAHJ | Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraA PE=3 SV=1 | 252 | 608 | 2.0E-18 |
sp|P33121|ACSL1_HUMAN | Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 | 44 | 562 | 2.0E-18 |
sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 242 | 611 | 2.0E-18 |
sp|B2HIN2|FAA26_MYCMM | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 | 215 | 608 | 2.0E-18 |
sp|Q39EK2|ACSA_BURL3 | Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 | 260 | 612 | 2.0E-18 |
sp|Q53634|MENE_STAAU | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|A8Z4L9|MENE_STAAT | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|A6QHX6|MENE_STAAE | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|Q5HEY2|MENE_STAAC | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|Q2G2V3|MENE_STAA8 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|Q2FFU9|MENE_STAA3 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 | 250 | 611 | 3.0E-18 |
sp|B2VFS7|AAS_ERWT9 | Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 | 253 | 615 | 3.0E-18 |
sp|C8VTR6|Y0074_EMENI | Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 | 247 | 615 | 4.0E-18 |
sp|B2HIL6|FAA22_MYCMM | p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 | 246 | 618 | 4.0E-18 |
sp|B2HIL4|FAA29_MYCMM | Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 | 248 | 622 | 5.0E-18 |
sp|Q08AH1|ACSM1_HUMAN | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 | 260 | 619 | 5.0E-18 |
sp|Q1BBA2|MBTM_MYCSS | Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium sp. (strain MCS) GN=mbtM PE=3 SV=1 | 249 | 612 | 6.0E-18 |
sp|Q32K60|CAIC_SHIDS | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 | 222 | 612 | 6.0E-18 |
sp|Q9BEA2|ACSM1_BOVIN | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 | 260 | 618 | 6.0E-18 |
sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 254 | 613 | 9.0E-18 |
sp|A7MR36|AAS_CROS8 | Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 | 253 | 605 | 1.0E-17 |
sp|Q72LY9|ACSA_LEPIC | Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 | 1 | 620 | 1.0E-17 |
sp|Q8BGA8|ACSM5_MOUSE | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 | 260 | 618 | 1.0E-17 |
sp|Q5HNB2|MENE_STAEQ | 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 | 255 | 623 | 1.0E-17 |
sp|A5JTM6|CBACL_PSEUC | 4-chlorobenzoate--CoA ligase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 | 250 | 611 | 2.0E-17 |
sp|Q7MGU3|ACSA_VIBVY | Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 | 27 | 621 | 2.0E-17 |
sp|E3UUE6|FAC19_RHORH | 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 | 225 | 605 | 2.0E-17 |
sp|Q8DCZ9|ACSA_VIBVU | Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 | 27 | 621 | 2.0E-17 |
sp|A1JPF0|AAS_YERE8 | Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 | 260 | 538 | 2.0E-17 |
sp|B2HHZ8|FAC17_MYCMM | Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 | 249 | 616 | 2.0E-17 |
sp|P9WQ59|FAA28_MYCTU | Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD28 PE=1 SV=1 | 256 | 619 | 2.0E-17 |
sp|P9WQ58|FAA28_MYCTO | Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD28 PE=3 SV=1 | 256 | 619 | 2.0E-17 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 215 | 608 | 3.0E-17 |
sp|Q02278|FAA28_MYCBO | Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD28 PE=3 SV=2 | 256 | 619 | 3.0E-17 |
sp|Q8EYG2|ACSA_LEPIN | Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 | 1 | 612 | 3.0E-17 |
sp|A4WE11|AAS_ENT38 | Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 | 253 | 605 | 3.0E-17 |
sp|A8AP56|AAS_CITK8 | Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 | 254 | 605 | 3.0E-17 |
sp|Q2NR28|ACSA_SODGM | Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 | 58 | 621 | 3.0E-17 |
sp|Q7MBA6|ACSA_PHOLL | Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 | 260 | 621 | 3.0E-17 |
sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 232 | 606 | 4.0E-17 |
sp|P9WQ61|FAA22_MYCTU | p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 | 246 | 618 | 4.0E-17 |
sp|P9WQ60|FAA22_MYCTO | p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 | 246 | 618 | 4.0E-17 |
sp|Q7TXK7|FAA22_MYCBO | p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 | 246 | 618 | 4.0E-17 |
sp|Q9JID6|ACSL1_CAVPO | Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 | 44 | 581 | 4.0E-17 |
sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 254 | 611 | 5.0E-17 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 251 | 608 | 5.0E-17 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 262 | 608 | 6.0E-17 |
sp|Q8FAY8|ACSA_ECOL6 | Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 | 23 | 621 | 7.0E-17 |
sp|Q04P35|ACSA_LEPBJ | Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 | 8 | 620 | 7.0E-17 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 247 | 611 | 9.0E-17 |
sp|P18163|ACSL1_RAT | Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 | 44 | 562 | 1.0E-16 |
sp|Q8ZKF6|ACSA_SALTY | Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 | 23 | 621 | 1.0E-16 |
sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 252 | 616 | 1.0E-16 |
sp|Q056J9|ACSA_LEPBL | Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 | 8 | 620 | 1.0E-16 |
sp|A8G8G7|ACSA_SERP5 | Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 | 23 | 621 | 1.0E-16 |
sp|Q8CS21|MENE_STAES | 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 | 255 | 623 | 1.0E-16 |
sp|A9IYZ3|ACSA_BART1 | Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 | 27 | 621 | 1.0E-16 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 262 | 608 | 2.0E-16 |
sp|Q8Z1R0|ACSA_SALTI | Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 | 23 | 621 | 2.0E-16 |
sp|P27550|ACSA_ECOLI | Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 | 23 | 621 | 3.0E-16 |
sp|P41216|ACSL1_MOUSE | Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 | 44 | 562 | 3.0E-16 |
sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 215 | 608 | 3.0E-16 |
sp|B2U6V1|ACSA_RALPJ | Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 | 251 | 612 | 3.0E-16 |
sp|Q1B6A7|MBTB_MYCSS | Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 | 252 | 608 | 4.0E-16 |
sp|A7MPJ7|ACSA_CROS8 | Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 | 23 | 621 | 4.0E-16 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 252 | 608 | 4.0E-16 |
sp|Q91VA0|ACSM1_MOUSE | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 | 260 | 619 | 5.0E-16 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 252 | 608 | 6.0E-16 |
sp|A4G3L8|ACSA_HERAR | Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 | 260 | 612 | 6.0E-16 |
sp|Q87C00|ACSA_XYLFT | Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 | 260 | 615 | 7.0E-16 |
sp|P48633|HMWP2_YERE8 | High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 | 253 | 567 | 7.0E-16 |
sp|Q73XY1|MBTB_MYCPA | Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 | 252 | 608 | 8.0E-16 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 253 | 608 | 1.0E-15 |
sp|P31686|4CL1_SOYBN | 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 | 324 | 617 | 1.0E-15 |
sp|Q8X5T5|ACSA_ECO57 | Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 | 23 | 621 | 1.0E-15 |
sp|Q63NC4|ACSA_BURPS | Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|A3NH07|ACSA_BURP6 | Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|Q3JH62|ACSA_BURP1 | Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|A3P2K7|ACSA_BURP0 | Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|A1UWN5|ACSA_BURMS | Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|Q62AD1|ACSA_BURMA | Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|A2RYW5|ACSA_BURM9 | Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|A3MG40|ACSA_BURM7 | Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-15 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 217 | 608 | 2.0E-15 |
sp|A1SZA2|ACSA_PSYIN | Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 | 27 | 618 | 2.0E-15 |
sp|A4Y7Y7|ACSA_SHEPC | Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 | 27 | 621 | 2.0E-15 |
sp|Q46Z41|ACSA_CUPPJ | Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 | 251 | 612 | 2.0E-15 |
sp|P27095|ACSA_METCN | Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 | 252 | 608 | 2.0E-15 |
sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 251 | 613 | 2.0E-15 |
sp|Q8XBV3|ENTE_ECO57 | Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 | 59 | 613 | 2.0E-15 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 252 | 608 | 3.0E-15 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 254 | 608 | 3.0E-15 |
sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 252 | 608 | 3.0E-15 |
sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 254 | 620 | 3.0E-15 |
sp|A3QD52|ACSA_SHELP | Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 | 59 | 621 | 3.0E-15 |
sp|Q1AXQ5|ACSA_RUBXD | Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 | 252 | 612 | 3.0E-15 |
sp|A0KY83|ACSA_SHESA | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 | 27 | 621 | 3.0E-15 |
sp|Q9ULC5|ACSL5_HUMAN | Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 | 44 | 532 | 3.0E-15 |
sp|A1RIK1|ACSA_SHESW | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 | 27 | 621 | 4.0E-15 |
sp|Q3ZKN0|S27A1_BOVIN | Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 | 27 | 624 | 4.0E-15 |
sp|Q6PCB7|S27A1_HUMAN | Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 | 27 | 624 | 4.0E-15 |
sp|B0SRX5|ACSA_LEPBP | Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 | 56 | 623 | 4.0E-15 |
sp|B0S8X7|ACSA_LEPBA | Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 | 56 | 623 | 4.0E-15 |
sp|B3R1X2|ACSA_CUPTR | Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 | 260 | 612 | 4.0E-15 |
sp|Q2KHW5|ACBG1_BOVIN | Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 | 253 | 548 | 4.0E-15 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 251 | 608 | 5.0E-15 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 217 | 608 | 5.0E-15 |
sp|P31638|ACSA_CUPNH | Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 | 251 | 612 | 5.0E-15 |
sp|B2JD61|ACSA_BURP8 | Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 | 260 | 612 | 5.0E-15 |
sp|Q0HHN4|ACSA_SHESM | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 | 27 | 621 | 5.0E-15 |
sp|Q9V3S9|BGM_DROME | Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 | 262 | 548 | 5.0E-15 |
sp|Q87KU7|ACSA_VIBPA | Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 | 27 | 621 | 5.0E-15 |
sp|P9WQ47|FAC23_MYCTU | Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 | 260 | 623 | 6.0E-15 |
sp|P9WQ46|FAC23_MYCTO | Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 | 260 | 623 | 6.0E-15 |
sp|Q7TVK7|FAC23_MYCBO | Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 | 260 | 623 | 6.0E-15 |
sp|Q9CMW1|ACSA_PASMU | Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 | 260 | 612 | 6.0E-15 |
sp|A6WM52|ACSA_SHEB8 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 | 27 | 621 | 7.0E-15 |
sp|A3D3E8|ACSA_SHEB5 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 | 27 | 621 | 7.0E-15 |
sp|Q0HTY6|ACSA_SHESR | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 | 27 | 621 | 8.0E-15 |
sp|E2JA29|DDAD_ENTAG | Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 | 246 | 625 | 9.0E-15 |
sp|Q7NSY7|ACSA_CHRVO | Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 | 60 | 624 | 9.0E-15 |
sp|Q7ZYC4|ACBG2_XENLA | Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 | 254 | 548 | 1.0E-14 |
sp|Q2NXE2|ACSA_XANOM | Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-14 |
sp|Q2G512|ACSA_NOVAD | Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 | 23 | 612 | 1.0E-14 |
sp|A1S7C8|ACSA_SHEAM | Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 | 262 | 621 | 1.0E-14 |
sp|Q8GVF9|4CLL8_ORYSJ | Putative 4-coumarate--CoA ligase-like 8 OS=Oryza sativa subsp. japonica GN=4CLL8 PE=3 SV=1 | 304 | 613 | 1.0E-14 |
sp|A9KY56|ACSA_SHEB9 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 | 27 | 621 | 1.0E-14 |
sp|Q99NB1|ACS2L_MOUSE | Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 | 44 | 621 | 1.0E-14 |
sp|Q084J4|ACSA_SHEFN | Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 | 27 | 621 | 1.0E-14 |
sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 262 | 608 | 2.0E-14 |
sp|Q9PB89|ACSA_XYLFA | Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 | 260 | 615 | 2.0E-14 |
sp|B2HI05|FAC19_MYCMM | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 | 244 | 605 | 2.0E-14 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 252 | 608 | 2.0E-14 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 260 | 611 | 2.0E-14 |
sp|Q2T3N9|ACSA_BURTA | Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 | 260 | 612 | 2.0E-14 |
sp|Q91WC3|ACSL6_MOUSE | Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 | 41 | 548 | 2.0E-14 |
sp|Q9UKU0|ACSL6_HUMAN | Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 | 41 | 548 | 2.0E-14 |
sp|P10378|ENTE_ECOLI | Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 | 245 | 613 | 2.0E-14 |
sp|Q8W471|AAE15_ARATH | Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 | 376 | 558 | 3.0E-14 |
sp|C1D6V9|ACSA_LARHH | Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 | 222 | 624 | 3.0E-14 |
sp|Q9NUB1|ACS2L_HUMAN | Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 | 8 | 621 | 3.0E-14 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 262 | 615 | 4.0E-14 |
sp|Q1LL27|ACSA_CUPMC | Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 | 260 | 612 | 4.0E-14 |
sp|P9WQ49|FAD21_MYCTU | Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 | 218 | 608 | 4.0E-14 |
sp|P9WQ48|FAD21_MYCTO | Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 | 218 | 608 | 4.0E-14 |
sp|P63524|FAD21_MYCBO | Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 | 218 | 608 | 4.0E-14 |
sp|Q8EDK3|ACSA_SHEON | Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 | 27 | 621 | 4.0E-14 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 215 | 611 | 5.0E-14 |
sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 251 | 611 | 5.0E-14 |
sp|Q5ZKR7|ACBG2_CHICK | Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 | 254 | 548 | 5.0E-14 |
sp|Q8XY11|ACSA_RALSO | Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 | 260 | 624 | 5.0E-14 |
sp|Q8LKS5|LACS7_ARATH | Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 | 249 | 577 | 6.0E-14 |
sp|Q3IFM6|ACSA_PSEHT | Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 | 247 | 612 | 6.0E-14 |
sp|Q9A2I0|ACSA_CAUCR | Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 | 247 | 619 | 6.0E-14 |
sp|O68040|ACSA_RHOCB | Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 | 49 | 612 | 7.0E-14 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 215 | 606 | 8.0E-14 |
sp|Q07VK4|ACSA_RHOP5 | Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 | 14 | 612 | 8.0E-14 |
sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 62 | 547 | 9.0E-14 |
sp|A0LG91|ACSA_SYNFM | Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 | 260 | 621 | 9.0E-14 |
sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 253 | 608 | 1.0E-13 |
sp|Q6G1W0|ACSA_BARHE | Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 | 27 | 621 | 1.0E-13 |
sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 232 | 611 | 1.0E-13 |
sp|Q8DKH2|ACSA_THEEB | Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 | 247 | 618 | 1.0E-13 |
sp|Q17WR1|ACSA_HELAH | Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 | 62 | 566 | 1.0E-13 |
sp|Q4R4P9|ACBG1_MACFA | Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 | 253 | 575 | 1.0E-13 |
sp|Q73ZP7|MBTM_MYCPA | Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtM PE=3 SV=1 | 243 | 612 | 2.0E-13 |
sp|Q8PF09|ACSA_XANAC | Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 | 260 | 612 | 2.0E-13 |
sp|Q5SIW6|ACSA_THET8 | Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 | 384 | 620 | 2.0E-13 |
sp|Q72J95|ACSA_THET2 | Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 | 384 | 620 | 2.0E-13 |
sp|Q8LPS1|LACS6_ARATH | Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 | 244 | 548 | 2.0E-13 |
sp|Q0AFF1|ACSA_NITEC | Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 | 262 | 615 | 2.0E-13 |
sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 251 | 611 | 3.0E-13 |
sp|Q96GR2|ACBG1_HUMAN | Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 | 253 | 548 | 3.0E-13 |
sp|Q82EL5|ACSA_STRAW | Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 | 40 | 615 | 3.0E-13 |
sp|Q8JZR0|ACSL5_MOUSE | Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 | 62 | 548 | 3.0E-13 |
sp|A8H5P1|ACSA_SHEPA | Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 | 59 | 621 | 4.0E-13 |
sp|O88561|S27A3_MOUSE | Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 | 262 | 614 | 4.0E-13 |
sp|A8FUF1|ACSA_SHESH | Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 | 59 | 621 | 4.0E-13 |
sp|B0TPY4|ACSA_SHEHH | Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 | 59 | 621 | 4.0E-13 |
sp|P54200|FAD21_MYCLE | Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 | 238 | 608 | 5.0E-13 |
sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 231 | 606 | 5.0E-13 |
sp|C0SPB0|YTCI_BACSU | Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 | 260 | 612 | 5.0E-13 |
sp|Q99PU5|ACBG1_MOUSE | Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 | 253 | 548 | 6.0E-13 |
sp|Q4LDG0|S27A5_MOUSE | Bile acyl-CoA synthetase OS=Mus musculus GN=Slc27a5 PE=1 SV=2 | 262 | 587 | 7.0E-13 |
sp|Q9Y7B5|ACS2_KLULA | Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 | 262 | 615 | 7.0E-13 |
sp|O88813|ACSL5_RAT | Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 | 62 | 548 | 7.0E-13 |
sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 231 | 606 | 7.0E-13 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 250 | 611 | 8.0E-13 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 215 | 608 | 8.0E-13 |
sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 215 | 543 | 8.0E-13 |
sp|Q336M7|4CLL2_ORYSJ | 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 | 260 | 584 | 8.0E-13 |
sp|P37353|MENE_ECOLI | 2-succinylbenzoate--CoA ligase OS=Escherichia coli (strain K12) GN=menE PE=1 SV=2 | 252 | 592 | 8.0E-13 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 256 | 608 | 1.0E-12 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 252 | 611 | 1.0E-12 |
sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 215 | 543 | 1.0E-12 |
sp|Q12MK0|ACSA_SHEDO | Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 | 262 | 621 | 1.0E-12 |
sp|P9WQ43|FAA26_MYCTU | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD26 PE=1 SV=1 | 215 | 608 | 1.0E-12 |
sp|P9WQ42|FAA26_MYCTO | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD26 PE=3 SV=1 | 215 | 608 | 1.0E-12 |
sp|P9WQ53|FAD11_MYCTU | Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 | 249 | 548 | 1.0E-12 |
sp|P9WQ52|FAD11_MYCTO | Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 | 249 | 548 | 1.0E-12 |
sp|O25686|ACSA_HELPY | Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 | 60 | 566 | 1.0E-12 |
sp|P97524|S27A2_RAT | Very long-chain acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a2 PE=1 SV=1 | 262 | 615 | 1.0E-12 |
sp|C0MBD6|DLTA_STRE4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 | 260 | 613 | 1.0E-12 |
sp|B2IB12|ACSA_BEII9 | Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 | 260 | 612 | 1.0E-12 |
sp|Q7TXM1|FAA26_MYCBO | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD26 PE=1 SV=1 | 215 | 608 | 1.0E-12 |
sp|P33124|ACSL6_RAT | Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 | 41 | 548 | 1.0E-12 |
sp|B5Z6E9|ACSA_HELPG | Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 | 60 | 566 | 1.0E-12 |
sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 240 | 606 | 2.0E-12 |
sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 260 | 611 | 2.0E-12 |
sp|O93730|ACSA_PYRAE | Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 | 56 | 612 | 2.0E-12 |
sp|Q9I4X3|PQSA_PSEAE | Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 | 254 | 612 | 2.0E-12 |
sp|Q55404|ACSA_SYNY3 | Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 | 238 | 612 | 2.0E-12 |
sp|C1AA44|ACSA_GEMAT | Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 | 252 | 618 | 2.0E-12 |
sp|Q48G09|ACSA_PSE14 | Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 | 27 | 618 | 2.0E-12 |
sp|Q1CUA3|ACSA_HELPH | Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 | 60 | 566 | 2.0E-12 |
sp|Q8P3L1|ACSA_XANCP | Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 | 260 | 612 | 2.0E-12 |
sp|Q4UP35|ACSA_XANC8 | Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 | 260 | 612 | 2.0E-12 |
sp|Q8KBY0|ACSA_CHLTE | Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 | 344 | 617 | 2.0E-12 |
sp|P9WQ51|FAC19_MYCTU | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 | 244 | 605 | 2.0E-12 |
sp|P9WQ50|FAC19_MYCTO | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 | 244 | 605 | 2.0E-12 |
sp|Q7TWB7|FAC19_MYCBO | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 | 244 | 605 | 2.0E-12 |
sp|B8FIN2|ACSA_DESAA | Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 | 260 | 621 | 2.0E-12 |
sp|A8FNJ7|ACSA_CAMJ8 | Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 | 75 | 612 | 2.0E-12 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 247 | 611 | 3.0E-12 |
sp|Q82SI5|ACSA_NITEU | Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 | 262 | 612 | 3.0E-12 |
sp|P36333|ACSA_PENCH | Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 | 252 | 612 | 3.0E-12 |
sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 215 | 543 | 3.0E-12 |
sp|Q4ZQG8|ACSA_PSEU2 | Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 | 56 | 618 | 3.0E-12 |
sp|A1U2S9|ACSA_MARHV | Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 | 27 | 612 | 3.0E-12 |
sp|Q3SLF4|ACSA_THIDA | Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 | 4 | 624 | 3.0E-12 |
sp|Q01576|ACSA_PHYB8 | Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 | 251 | 624 | 3.0E-12 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 253 | 623 | 4.0E-12 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 250 | 611 | 4.0E-12 |
sp|B9DGD6|ACS_ARATH | Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 | 328 | 621 | 4.0E-12 |
sp|B6JKX8|ACSA_HELP2 | Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain P12) GN=acsA PE=3 SV=1 | 60 | 566 | 4.0E-12 |
sp|C1CB20|DLTA_STRP7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 | 260 | 606 | 4.0E-12 |
sp|A7IFD4|ACSA_XANP2 | Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 | 27 | 621 | 4.0E-12 |
sp|Q60714|S27A1_MOUSE | Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 | 27 | 624 | 4.0E-12 |
sp|A0B8F1|ACSA_METTP | Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 | 252 | 618 | 5.0E-12 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 253 | 608 | 6.0E-12 |
sp|Q924N5|ACBG1_RAT | Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 | 253 | 548 | 6.0E-12 |
sp|Q48SZ3|DLTA_STRPM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 | 260 | 614 | 6.0E-12 |
sp|A2RE45|DLTA_STRPG | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 | 260 | 614 | 6.0E-12 |
sp|Q1JGF0|DLTA_STRPD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 | 260 | 614 | 6.0E-12 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 255 | 608 | 1.0E-11 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 217 | 608 | 1.0E-11 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 241 | 611 | 2.0E-11 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 240 | 611 | 2.0E-11 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 240 | 611 | 2.0E-11 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 260 | 611 | 3.0E-11 |
sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 252 | 613 | 3.0E-11 |
sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 257 | 608 | 1.0E-10 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 256 | 608 | 1.0E-10 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 262 | 611 | 9.0E-10 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 251 | 611 | 1.0E-09 |
sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 233 | 547 | 3.0E-09 |
sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 233 | 547 | 3.0E-09 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 255 | 611 | 6.0E-09 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 260 | 611 | 1.0E-08 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 260 | 611 | 1.0E-08 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 215 | 606 | 8.0E-08 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 252 | 611 | 1.0E-07 |
sp|P9WQ37|FAC13_MYCTU | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 | 43 | 142 | 1.0E-06 |
sp|P9WQ36|FAC13_MYCTO | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 | 43 | 142 | 1.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 17 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|3692 MILFRRLLSTATLSFARGPSQPSLLTNTIPSHLSTIVNRHGTRPAVISRTPSRHGPPRETTLTYSALDALSSHLA RQLLRIANIKAGDRIVVSLGNGHEFAALTYAVYKLGAVLVPLNPTLGPEQVKAALTFLSARVVVLGAAVDLAYRP GRGRSNARLVDSIVGGKRPEGLERVVLLDNREQHQADVFDDDVDAGLFDCLDGRGDGFVVPYSELLDSKSSLLTT STSASASSSVSTSPSLSPSPPADFPPLSPSSITNIQFTSGTTSTPKAAQLSHRSILNNGNLIAHRMGLVPSDAIV VPPPLFHCFGSVLGYMATATTGAAILFPSPAFDPVAALRMAIDHDATGLYGVPTMFIAMLEALDKMDEKPARLTK GIASGSSVPESLMRRIHDRLGLSDLVICYGQTETGPVSCMTTPGDPPDKLLSSVGRPLPHTAVKIVSPADRSVIV PIGEKGELVASGYHLMEGYYDDADRTAEVRVREPNVDGSGDSIWMYSGDQAVMSADGYVSITGRIKDLIIRGGEN INPLEIEECLAQLPAIRDVSVVGVPCPRLGEAVAAFVRPADDNLTADAVRDWVRDRLSSHLVPKHVLFWSDEFPK TASGKVQKFKLRDEAVAKLQNSEQS* |
Coding | >Ophun1|3692 ATGATCCTCTTCCGCCGCCTCCTCTCTACCGCAACCCTCAGCTTCGCCCGCGGTCCCTCCCAACCAAGCCTCCTC ACCAACACCATCCCCTCCCACCTCTCAACCATCGTCAACCGCCACGGCACCCGCCCCGCCGTCATCTCCCGCACG CCCTCCCGCCACGGCCCCCCCCGGGAAACAACCCTAACCTACAGCGCCCTAGACGCCCTCTCGTCTCACCTCGCG CGGCAGCTCCTCCGCATAGCCAACATCAAGGCGGGAGATCGCATCGTCGTCTCGCTCGGCAACGGGCATGAATTC GCGGCCCTCACCTACGCCGTGTACAAGTTGGGCGCTGTGCTCGTGCCGCTTAACCCGACGCTGGGGCCGGAGCAG GTCAAGGCTGCCTTGACCTTCTTGTCCGCGAGGGTCGTGGTGCTGGGCGCTGCTGTGGACTTGGCCTATCGTCCG GGAAGGGGGAGGAGTAATGCTCGCCTTGTGGATAGTATCGTGGGAGGGAAGAGGCCTGAGGGATTGGAGAGGGTG GTGTTGCTGGATAATCGGGAGCAGCATCAGGCGGATGTGTTTGATGACGACGTCGACGCTGGCTTATTCGATTGT CTGGACGGACGGGGCGATGGCTTTGTCGTTCCCTACTCGGAGCTCCTCGACTCCAAGTCGTCATTGCTTACAACA TCGACATCAGCATCGGCATCATCATCAGTATCAACATCACCATCATTATCACCATCACCACCAGCAGACTTCCCC CCCCTCTCCCCCTCATCCATCACCAACATCCAATTCACCTCCGGCACAACCTCCACCCCCAAAGCCGCCCAGCTC TCCCACCGCTCCATCCTCAACAACGGCAACCTCATCGCCCACCGCATGGGCCTCGTCCCCTCCGACGCCATCGTC GTCCCCCCTCCGCTCTTCCACTGCTTCGGCTCCGTCCTCGGCTACATGGCCACCGCCACCACCGGAGCCGCCATC CTCTTCCCCAGCCCGGCCTTTGATCCCGTCGCCGCGCTGCGTATGGCTATCGATCACGACGCTACCGGTCTGTAC GGCGTGCCTACCATGTTCATCGCCATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCTAGACTTACAAAG GGCATCGCCTCGGGAAGCAGCGTCCCCGAATCGCTGATGCGTCGCATTCACGATCGTCTCGGCCTCAGCGACCTC GTCATCTGCTACGGCCAGACCGAGACGGGGCCCGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTC CTCTCCTCCGTCGGCCGCCCGCTGCCGCACACGGCCGTCAAGATCGTCTCGCCCGCCGACCGGTCCGTCATCGTG CCCATAGGCGAGAAGGGCGAGCTCGTCGCCTCGGGATACCACCTCATGGAAGGCTACTACGACGATGCCGACCGC ACGGCAGAGGTCCGCGTCCGCGAGCCTAATGTCGACGGCAGCGGCGACTCGATTTGGATGTATTCGGGCGACCAG GCCGTCATGTCGGCTGACGGATACGTGTCCATCACCGGCCGCATCAAGGACCTCATCATTCGAGGCGGTGAGAAC ATCAATCCGCTCGAGATTGAGGAATGTCTCGCCCAGCTTCCCGCCATACGCGATGTCAGCGTCGTTGGCGTTCCC TGTCCGCGTCTTGGCGAGGCCGTCGCCGCCTTTGTCCGGCCCGCCGACGACAATCTGACAGCTGATGCCGTCCGC GATTGGGTCCGAGACCGACTTTCCAGCCACCTGGTGCCCAAGCATGTCTTGTTCTGGTCCGACGAGTTCCCAAAG ACGGCCAGCGGCAAGGTTCAAAAGTTTAAGCTCCGCGACGAGGCAGTTGCCAAGCTCCAAAACTCCGAGCAATCC TAA |
Transcript | >Ophun1|3692 ATGATCCTCTTCCGCCGCCTCCTCTCTACCGCAACCCTCAGCTTCGCCCGCGGTCCCTCCCAACCAAGCCTCCTC ACCAACACCATCCCCTCCCACCTCTCAACCATCGTCAACCGCCACGGCACCCGCCCCGCCGTCATCTCCCGCACG CCCTCCCGCCACGGCCCCCCCCGGGAAACAACCCTAACCTACAGCGCCCTAGACGCCCTCTCGTCTCACCTCGCG CGGCAGCTCCTCCGCATAGCCAACATCAAGGCGGGAGATCGCATCGTCGTCTCGCTCGGCAACGGGCATGAATTC GCGGCCCTCACCTACGCCGTGTACAAGTTGGGCGCTGTGCTCGTGCCGCTTAACCCGACGCTGGGGCCGGAGCAG GTCAAGGCTGCCTTGACCTTCTTGTCCGCGAGGGTCGTGGTGCTGGGCGCTGCTGTGGACTTGGCCTATCGTCCG GGAAGGGGGAGGAGTAATGCTCGCCTTGTGGATAGTATCGTGGGAGGGAAGAGGCCTGAGGGATTGGAGAGGGTG GTGTTGCTGGATAATCGGGAGCAGCATCAGGCGGATGTGTTTGATGACGACGTCGACGCTGGCTTATTCGATTGT CTGGACGGACGGGGCGATGGCTTTGTCGTTCCCTACTCGGAGCTCCTCGACTCCAAGTCGTCATTGCTTACAACA TCGACATCAGCATCGGCATCATCATCAGTATCAACATCACCATCATTATCACCATCACCACCAGCAGACTTCCCC CCCCTCTCCCCCTCATCCATCACCAACATCCAATTCACCTCCGGCACAACCTCCACCCCCAAAGCCGCCCAGCTC TCCCACCGCTCCATCCTCAACAACGGCAACCTCATCGCCCACCGCATGGGCCTCGTCCCCTCCGACGCCATCGTC GTCCCCCCTCCGCTCTTCCACTGCTTCGGCTCCGTCCTCGGCTACATGGCCACCGCCACCACCGGAGCCGCCATC CTCTTCCCCAGCCCGGCCTTTGATCCCGTCGCCGCGCTGCGTATGGCTATCGATCACGACGCTACCGGTCTGTAC GGCGTGCCTACCATGTTCATCGCCATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCTAGACTTACAAAG GGCATCGCCTCGGGAAGCAGCGTCCCCGAATCGCTGATGCGTCGCATTCACGATCGTCTCGGCCTCAGCGACCTC GTCATCTGCTACGGCCAGACCGAGACGGGGCCCGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTC CTCTCCTCCGTCGGCCGCCCGCTGCCGCACACGGCCGTCAAGATCGTCTCGCCCGCCGACCGGTCCGTCATCGTG CCCATAGGCGAGAAGGGCGAGCTCGTCGCCTCGGGATACCACCTCATGGAAGGCTACTACGACGATGCCGACCGC ACGGCAGAGGTCCGCGTCCGCGAGCCTAATGTCGACGGCAGCGGCGACTCGATTTGGATGTATTCGGGCGACCAG GCCGTCATGTCGGCTGACGGATACGTGTCCATCACCGGCCGCATCAAGGACCTCATCATTCGAGGCGGTGAGAAC ATCAATCCGCTCGAGATTGAGGAATGTCTCGCCCAGCTTCCCGCCATACGCGATGTCAGCGTCGTTGGCGTTCCC TGTCCGCGTCTTGGCGAGGCCGTCGCCGCCTTTGTCCGGCCCGCCGACGACAATCTGACAGCTGATGCCGTCCGC GATTGGGTCCGAGACCGACTTTCCAGCCACCTGGTGCCCAAGCATGTCTTGTTCTGGTCCGACGAGTTCCCAAAG ACGGCCAGCGGCAAGGTTCAAAAGTTTAAGCTCCGCGACGAGGCAGTTGCCAAGCTCCAAAACTCCGAGCAATCC TAA |
Gene | >Ophun1|3692 ATGATCCTCTTCCGCCGCCTCCTCTCTACCGCAACCCTCAGCTTCGCCCGCGGTCCCTCCCAAGTCCGTCATCCC CCTCACCACCTCACACCCACCCCCATAACTAACACCCAACTCCCAGCCAAGCCTCCTCACCAACACCATCCCCTC CCACCTCTCAACCATCGTCAACCGCCACGGCACCCGCCCCGCCGTCATCTCCCGCACGCCCTCCCGCCACGGCCC CCCCCGGGAAACAACCCTAACCTACAGCGCCCTAGACGCCCTCTCGTCTCACCTCGCGCGGCAGCTCCTCCGCAT AGCCAACATCAAGGCGGGAGATCGCATCGTCGTCTCGCTCGGCAACGGGCATGAATTCGCGGCCCTCACCTACGC CGTGTACAAGTTGGGCGCTGTGCTCGTGCCGCTTAACCCGACGCTGGGGCCGGAGCAGGTCAAGGCTGCCTTGAC CTTCTTGTCCGCGAGGGTCGTGGTGCTGGGCGCTGCTGTGGACTTGGCCTATCGTCCGGGAAGGGGGAGGAGTAA TGCTCGCCTTGTGGATAGTATCGTGGGAGGGAAGAGGCCTGAGGGATTGGAGAGGGTGGTGTTGCTGGATAATCG GGAGCAGCATCAGGCGGATGTGTTTGATGACGACGTCGACGCTGGCTTATTCGATTGTCTGGACGGACGGGGCGA TGGCTTTGTCGTTCCCTACTCGGAGCTCCTCGACTCCAAGTCGTCATTGCTTACAACATCGACATCAGCATCGGC ATCATCATCAGTATCAACATCACCATCATTATCACCATCACCACCAGCAGACTTCCCCCCCCTCTCCCCCTCATC CATCACCAACATCCAATTCACCTCCGGCACAACCTCCACCCCCAAAGCCGCCCAGCTCTCCCACCGCTCCATCCT CAACAACGGCAACCTCATCGCCCACCGCATGGGCCTCGTCCCCTCCGACGCCATCGTCGTCCCCCCTCCGCTCTT CCACTGCTTCGGCTCCGTCCTCGGCTACATGGCCACCGCCACCACCGGAGCCGCCATCCTCTTCCCCAGCCCGGC CTTTGATCCCGTCGCCGCGCTGCGTATGGCTATCGATCACGACGCTACCGGTCTGTACGGCGTGCCTACCATGTT CATCGCCATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCTAGACTTACAAAGGGCATCGCCTCGGGAAG CAGCGTCCCCGAATCGCTGATGCGTCGCATTCACGATCGTCTCGGCCTCAGCGACCTCGTCATCTGCTACGGCCA GACCGAGACGGGGCCCGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTCCTCTCCTCCGTCGGCCG CCCGCTGCCGCACACGGCCGTCAAGATCGTCTCGCCCGCCGACCGGTCCGTCATCGTGCCCATAGGCGAGAAGGG CGAGCTCGTCGCCTCGGGATACCACCTCATGGAAGGCTACTACGACGATGCCGACCGCACGGCAGAGGTCCGCGT CCGCGAGCCTAATGTCGACGGCAGCGGCGACTCGATTTGGATGTATTCGGGCGACCAGGCCGTCATGTCGGCTGA CGGATACGTGTCCATCACCGGCCGCATCAAGGACCTCATCATTCGAGGCGGTGAGAACATCAATCCGCTCGAGAT TGAGGAATGTCTCGCCCAGCTTCCCGCCATACGCGATGTCAGCGTCGTTGGCGTTCCCTGTCCGCGTCTTGGCGA GGCCGTCGCCGCCTTTGTCCGGCCCGCCGACGACAATCTGACAGCTGATGCCGTCCGCGATTGGGTCCGAGACCG ACTTTCCAGCCACCTGGTGCCCAAGCATGTCTTGTTCTGGTCCGACGAGTTCCCAAAGACGGCCAGCGGCAAGGT TCAAAAGTTTAAGCTCCGCGACGAGGCAGTTGCCAAGCTCCAAAACTCCGAGCAATCCTAA |