Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3690
Gene name
LocationContig_33:30998..31965
Strand-
Gene length (bp)967
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 3.5E-53 72 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74888|BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bxi1 PE=3 SV=1 5 279 6.0E-54
sp|Q9DA39|LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus GN=Tmbim4 PE=2 SV=1 44 279 8.0E-49
sp|Q9HC24|LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=3 46 279 3.0E-46
sp|Q49P94|GAAP_VACCL Golgi anti-apoptotic protein OS=Vaccinia virus (strain Lister) GN=L6 PE=1 SV=1 48 264 8.0E-44
sp|P48558|BXI1_YEAST Bax inhibitor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BXI1 PE=1 SV=1 24 279 6.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74888|BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bxi1 PE=3 SV=1 5 279 6.0E-54
sp|Q9DA39|LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus GN=Tmbim4 PE=2 SV=1 44 279 8.0E-49
sp|Q9HC24|LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=3 46 279 3.0E-46
sp|Q49P94|GAAP_VACCL Golgi anti-apoptotic protein OS=Vaccinia virus (strain Lister) GN=L6 PE=1 SV=1 48 264 8.0E-44
sp|P48558|BXI1_YEAST Bax inhibitor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BXI1 PE=1 SV=1 24 279 6.0E-36
sp|Q1LZ71|LFG2_BOVIN Protein lifeguard 2 OS=Bos taurus GN=FAIM2 PE=2 SV=1 8 274 1.0E-32
sp|Q7Z429|LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens GN=GRINA PE=2 SV=1 70 274 1.0E-31
sp|Q9BWQ8|LFG2_HUMAN Protein lifeguard 2 OS=Homo sapiens GN=FAIM2 PE=1 SV=1 7 274 3.0E-31
sp|Q94A20|BI1L_ARATH BI1-like protein OS=Arabidopsis thaliana GN=At4g15470 PE=2 SV=1 24 278 5.0E-31
sp|Q5R4I4|LFG2_PONAB Protein lifeguard 2 OS=Pongo abelii GN=FAIM2 PE=2 SV=1 7 274 8.0E-31
sp|Q9ESF4|LFG1_MOUSE Protein lifeguard 1 OS=Mus musculus GN=Grina PE=2 SV=1 69 274 3.0E-30
sp|Q8K097|LFG2_MOUSE Protein lifeguard 2 OS=Mus musculus GN=Faim2 PE=2 SV=1 69 274 4.0E-30
sp|Q6P6R0|LFG1_RAT Protein lifeguard 1 OS=Rattus norvegicus GN=Grina PE=2 SV=1 69 274 8.0E-30
sp|O88407|LFG2_RAT Protein lifeguard 2 OS=Rattus norvegicus GN=Faim2 PE=2 SV=1 23 274 4.0E-29
sp|Q32L53|LFG1_BOVIN Protein lifeguard 1 OS=Bos taurus GN=GRINA PE=2 SV=1 69 274 5.0E-27
sp|Q969X1|LFG3_HUMAN Protein lifeguard 3 OS=Homo sapiens GN=TMBIM1 PE=1 SV=2 69 277 3.0E-24
sp|Q8BJZ3|LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus GN=Tmbim1 PE=1 SV=1 69 277 9.0E-22
sp|Q11080|TMBI4_CAEEL Transmembrane BAX inhibitor motif-containing protein 4 OS=Caenorhabditis elegans GN=tmbi-4 PE=3 SV=2 61 273 3.0E-21
sp|Q9PIQ8|Y236_CAMJE Uncharacterized protein Cj0236c OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0236c PE=3 SV=1 74 274 7.0E-16
sp|Q9A1B9|Y358_STRP1 Uncharacterized membrane protein SPy_0358/M5005_Spy0301 OS=Streptococcus pyogenes serotype M1 GN=SPy_0358 PE=3 SV=1 72 272 6.0E-13
sp|Q8P2D4|Y408_STRP8 Uncharacterized membrane protein spyM18_0408 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_0408 PE=3 SV=1 72 272 7.0E-13
sp|Q5XDQ1|Y327_STRP6 Uncharacterized membrane protein M6_Spy0327 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0327 PE=3 SV=1 72 272 7.0E-13
sp|P0DA11|Y260_STRPQ Uncharacterized membrane protein SPs1599 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1599 PE=3 SV=1 72 272 1.0E-12
sp|P0DA10|Y260_STRP3 Uncharacterized membrane protein SpyM3_0260 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0260 PE=3 SV=1 72 272 1.0E-12
sp|Q9ZKT1|Y920_HELPJ Uncharacterized protein jhp_0854 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0854 PE=3 SV=1 86 274 4.0E-12
sp|O25578|Y920_HELPY Uncharacterized protein HP_0920 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0920 PE=3 SV=1 86 274 4.0E-11
sp|Q9KSA1|Y1358_VIBCH Uncharacterized membrane protein VC_1358 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1358 PE=3 SV=1 163 279 9.0E-11
sp|O51489|Y539_BORBU Uncharacterized protein BB_0539 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0539 PE=3 SV=1 70 279 3.0E-10
sp|O31539|YETJ_BACSU Uncharacterized protein YetJ OS=Bacillus subtilis (strain 168) GN=yetJ PE=1 SV=1 126 279 6.0E-10
sp|P09723|US21_HCMVA Uncharacterized protein HWLF2 OS=Human cytomegalovirus (strain AD169) GN=US21 PE=3 SV=1 71 279 2.0E-07
sp|F5HHT6|US21_HCMVM Membrane protein US21 OS=Human cytomegalovirus (strain Merlin) GN=US21 PE=3 SV=1 71 279 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 110 129 19
3 163 182 19
4 192 214 22
5 221 243 22
6 253 275 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3690
MATNAKYQPAPQREPEDDDYTHAPPAYAAASSSAARDEAQGLFGAPRSSEDNLPDDFKFGGSVAEATVDIRNQFI
RKVYTILTIQLLATAGLSGVSFFNASYKSWIQHHPALVWVSLIASLVFMGLTYWKRKSYPTNLLFLTAFTLTEAY
TISVIVSFYKTSIVLNAVVLTAGIFIFLTAFACQTKYDFTSWMPYLFGAVWGLFLFGLVAVFLPYNSTVELIYGG
VAALIFSAYILVDTQLVLRKHHVEEEIAAAISLYLDIINLFLAILRILNGQSNN*
Coding >Ophun1|3690
ATGGCCACCAACGCAAAGTACCAACCCGCGCCCCAGCGCGAGCCCGAAGACGACGACTACACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAAGCTCAGGGTCTCTTTGGGGCCCCGCGCTCCAGCGAG
GATAATCTTCCGGATGACTTCAAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATC
CGCAAAGTCTACACCATCCTCACCATCCAGCTCCTCGCAACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCC
TCGTACAAGTCGTGGATCCAGCACCACCCAGCTCTCGTCTGGGTTTCCCTCATCGCCTCCCTCGTTTTCATGGGC
TTGACCTACTGGAAGCGCAAGTCGTACCCGACCAACCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTAC
ACCATCTCCGTCATCGTCTCCTTCTACAAGACCTCCATCGTCCTCAACGCCGTTGTCCTCACTGCTGGTATCTTC
ATCTTCCTAACCGCCTTCGCTTGCCAGACAAAGTACGATTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTC
TGGGGCCTCTTCCTCTTCGGTCTCGTCGCAGTCTTCCTGCCGTACAACTCCACCGTCGAGCTCATCTACGGTGGC
GTCGCTGCTCTCATCTTCAGCGCCTACATCCTCGTCGACACCCAGCTGGTTCTCCGCAAGCACCACGTCGAGGAA
GAGATCGCCGCAGCCATCAGCCTGTATCTCGACATCATCAATCTGTTCCTCGCCATCCTGCGCATCCTCAACGGC
CAGTCTAACAATTAG
Transcript >Ophun1|3690
ATGGCCACCAACGCAAAGTACCAACCCGCGCCCCAGCGCGAGCCCGAAGACGACGACTACACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAAGCTCAGGGTCTCTTTGGGGCCCCGCGCTCCAGCGAG
GATAATCTTCCGGATGACTTCAAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATC
CGCAAAGTCTACACCATCCTCACCATCCAGCTCCTCGCAACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCC
TCGTACAAGTCGTGGATCCAGCACCACCCAGCTCTCGTCTGGGTTTCCCTCATCGCCTCCCTCGTTTTCATGGGC
TTGACCTACTGGAAGCGCAAGTCGTACCCGACCAACCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTAC
ACCATCTCCGTCATCGTCTCCTTCTACAAGACCTCCATCGTCCTCAACGCCGTTGTCCTCACTGCTGGTATCTTC
ATCTTCCTAACCGCCTTCGCTTGCCAGACAAAGTACGATTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTC
TGGGGCCTCTTCCTCTTCGGTCTCGTCGCAGTCTTCCTGCCGTACAACTCCACCGTCGAGCTCATCTACGGTGGC
GTCGCTGCTCTCATCTTCAGCGCCTACATCCTCGTCGACACCCAGCTGGTTCTCCGCAAGCACCACGTCGAGGAA
GAGATCGCCGCAGCCATCAGCCTGTATCTCGACATCATCAATCTGTTCCTCGCCATCCTGCGCATCCTCAACGGC
CAGTCTAACAATTAG
Gene >Ophun1|3690
ATGGCCACCAACGCAAAGTACCAACCCGCGCCCCAGCGCGAGCCCGAAGACGACGACTACACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAAGCTCAGGGTCTCTTTGGGGCCCCGCGCTCCAGCGAG
GATAATCTTCCGGATGACTTCAAGGTGCTTCTTTTTCAAGTGACCCCTCCCCTATCATCTTTGTCGAGTTGCTGA
CAGCTTGTCCCTCAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATCCGCAAAGTC
TACACCATCCTCACCATCCAGCTCCTCGCAACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCCTCGTACAAG
TCGTGGATCCAGCACCACCCAGCTCTCGTCTGGGTTTCCGTGCGTTTTCCCTCCTCGAACCGTATCTCCCTCTGC
CATCTCACGCTGACACTGCGTACAGCTCATCGCCTCCCTCGTTTTCATGGGCTTGACCTACTGGAAGCGCAAGTC
GTACCCGACCAACCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTACACCATCTCCGTCATCGTCTCCTT
CTACAAGACCTCCATCGTCCTCAACGCCGTTGTCCTCACTGCTGGTATCTTCATCTTCCTAACCGCCTTCGCTTG
CCAGACAAAGTACGATTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTCTGGGGCCTCTTCCTCTTCGGTCT
CGTCGCAGTCTTCCTGCCGTACAACTCCACCGTCGAGCTCATCTACGGTGGCGTCGCTGCTCTCATCTTCAGCGC
CTACATCCTCGTCGACACCCAGCTGGTTCTCCGCAAGCACCACGTCGAGGAAGAGATCGCCGCAGCCATCAGCCT
GTATCTCGACATCATCAATCTGTTCCTCGCCATCCTGCGCATCCTCAACGGCCAGTCTAACAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail