Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3680
Gene name
LocationContig_33:10663..11808
Strand+
Gene length (bp)1145
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 2.0E-38 54 299
PF00463 ICL Isocitrate lyase family 8.2E-19 109 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 50 310 5.0E-54
sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 51 322 3.0E-47
sp|P54528|PRPB_BACSU 2-methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 50 306 3.0E-41
sp|Q9YFM7|PRPB_AERPE 2-methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 57 334 2.0E-40
sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=2 SV=2 57 321 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 50 310 5.0E-54
sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 51 322 3.0E-47
sp|P54528|PRPB_BACSU 2-methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 50 306 3.0E-41
sp|Q9YFM7|PRPB_AERPE 2-methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 57 334 2.0E-40
sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=2 SV=2 57 321 5.0E-38
sp|Q9Z9T7|PRPB_BACHD 2-methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 55 306 1.0E-37
sp|Q8NSH8|PRPB1_CORGL Probable 2-methylisocitrate lyase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB1 PE=3 SV=1 67 306 3.0E-36
sp|D4GTL3|ACEA_HALVD Isocitrate lyase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aceA PE=1 SV=1 50 231 5.0E-35
sp|Q56062|PRPB_SALTY 2-methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpB PE=1 SV=3 53 327 2.0E-34
sp|Q8NSL2|PRPB2_CORGL Probable 2-methylisocitrate lyase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB2 PE=3 SV=1 62 307 2.0E-34
sp|P77541|PRPB_ECOLI 2-methylisocitrate lyase OS=Escherichia coli (strain K12) GN=prpB PE=1 SV=3 53 327 4.0E-34
sp|Q937P0|PRPB_CUPNE 2-methylisocitrate lyase OS=Cupriavidus necator GN=prpB PE=1 SV=1 48 324 9.0E-32
sp|Q8EJW1|PRPB_SHEON 2-methylisocitrate lyase OS=Shewanella oneidensis (strain MR-1) GN=prpB PE=3 SV=1 48 306 1.0E-31
sp|Q9KSC2|PRPB_VIBCH 2-methylisocitrate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prpB PE=3 SV=1 44 296 2.0E-31
sp|Q05957|PDP_DIACA Petal death protein OS=Dianthus caryophyllus GN=PDP PE=1 SV=1 57 320 2.0E-30
sp|C1DEN4|OADC_AZOVD Oxaloacetate decarboxylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=Avin_20130 PE=3 SV=1 55 319 3.0E-21
sp|B1J195|OADC1_PSEPW Oxaloacetate decarboxylase 1 OS=Pseudomonas putida (strain W619) GN=PputW619_1029 PE=3 SV=1 46 319 7.0E-21
sp|B0KV77|OADC_PSEPG Oxaloacetate decarboxylase OS=Pseudomonas putida (strain GB-1) GN=PputGB1_4424 PE=3 SV=1 46 319 1.0E-20
sp|Q88N27|OADC_PSEPK Oxaloacetate decarboxylase OS=Pseudomonas putida (strain KT2440) GN=PP_1389 PE=3 SV=2 46 305 4.0E-20
sp|A5W8J7|OADC_PSEP1 Oxaloacetate decarboxylase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_4334 PE=3 SV=1 46 305 4.0E-20
sp|Q1I5P3|OADC_PSEE4 Oxaloacetate decarboxylase OS=Pseudomonas entomophila (strain L48) GN=PSEEN4356 PE=3 SV=1 55 301 8.0E-19
sp|Q1R0Z3|OADC_CHRSD Oxaloacetate decarboxylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_0251 PE=3 SV=1 55 299 1.0E-18
sp|Q3KEL1|OADC1_PSEPF Oxaloacetate decarboxylase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_2052 PE=3 SV=1 55 319 2.0E-18
sp|Q4KDX1|OADC_PSEF5 Oxaloacetate decarboxylase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_2455 PE=3 SV=1 55 319 1.0E-17
sp|Q48LY6|OADC_PSE14 Oxaloacetate decarboxylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_1328 PE=3 SV=1 46 319 1.0E-17
sp|Q4ZX15|OADC_PSEU2 Oxaloacetate decarboxylase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_1256 PE=3 SV=1 46 319 2.0E-17
sp|C3KBB4|OADC_PSEFS Oxaloacetate decarboxylase OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_3105 PE=3 SV=1 55 299 3.0E-17
sp|A4VQV5|OADC_PSEU5 Oxaloacetate decarboxylase OS=Pseudomonas stutzeri (strain A1501) GN=PST_3733 PE=3 SV=1 55 299 3.0E-17
sp|Q886Y2|OADC_PSESM Oxaloacetate decarboxylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_1443 PE=3 SV=1 46 319 4.0E-17
sp|A6VZF8|OADC_MARMS Oxaloacetate decarboxylase OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_2926 PE=3 SV=1 55 299 4.0E-17
sp|A4YT21|OADC_BRASO Oxaloacetate decarboxylase OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO3250 PE=3 SV=1 53 314 4.0E-17
sp|Q6N509|OADC_RHOPA Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA3174 PE=3 SV=1 53 315 5.0E-17
sp|A6VCY0|OADC_PSEA7 Oxaloacetate decarboxylase OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_5594 PE=3 SV=2 52 319 1.0E-16
sp|Q13Q00|OADC_BURXL Oxaloacetate decarboxylase OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_B0871 PE=3 SV=1 46 304 1.0E-16
sp|B3QAW1|OADC_RHOPT Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_3584 PE=3 SV=1 53 315 2.0E-16
sp|Q9HUU1|OADC_PSEAE Oxaloacetate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA4872 PE=1 SV=1 52 319 2.0E-16
sp|Q02FE6|OADC_PSEAB Oxaloacetate decarboxylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_64440 PE=3 SV=1 52 319 2.0E-16
sp|B7V1T5|OADC_PSEA8 Oxaloacetate decarboxylase OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_52581 PE=3 SV=1 52 319 2.0E-16
sp|P56839|PEPM_MYTED Phosphoenolpyruvate phosphomutase OS=Mytilus edulis PE=1 SV=3 43 298 2.0E-16
sp|P29247|PEPM_STRHY Phosphoenolpyruvate phosphomutase OS=Streptomyces hygroscopicus GN=bcpB PE=3 SV=1 68 343 3.0E-16
sp|A4XQ41|OADC_PSEMY Oxaloacetate decarboxylase OS=Pseudomonas mendocina (strain ymp) GN=Pmen_0689 PE=3 SV=1 55 299 6.0E-16
sp|Q07L14|OADC_RHOP5 Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain BisA53) GN=RPE_3438 PE=3 SV=1 69 315 1.0E-15
sp|Q135C1|OADC_RHOPS Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_3092 PE=3 SV=1 55 315 6.0E-15
sp|Q89JL7|OADC_BRADU Oxaloacetate decarboxylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bll5266 PE=3 SV=1 52 303 7.0E-15
sp|A5EL79|OADC_BRASB Oxaloacetate decarboxylase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_4901 PE=3 SV=1 53 336 1.0E-14
sp|P41555|ACEA_YARLI Isocitrate lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ICL1 PE=3 SV=3 43 208 1.0E-14
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 112 208 2.0E-14
sp|Q6BRY4|ACEA_DEBHA Isocitrate lyase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ICL1 PE=3 SV=1 46 208 3.0E-14
sp|Q6T267|ACEA_ASPFU Isocitrate lyase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=icl1 PE=3 SV=2 46 208 3.0E-14
sp|Q211P3|OADC_RHOPB Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_3351 PE=3 SV=1 69 299 3.0E-14
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 107 208 4.0E-14
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 100 208 1.0E-13
sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase OS=Leptosphaeria maculans GN=ICL1 PE=2 SV=1 77 208 1.0E-13
sp|Q9HFN2|ACEA_CYBJA Isocitrate lyase OS=Cyberlindnera jadinii GN=ICL1 PE=3 SV=1 50 208 2.0E-13
sp|Q96WZ5|ACEA_TALMA Isocitrate lyase OS=Talaromyces marneffei GN=icl1 PE=3 SV=1 112 208 2.0E-13
sp|P28298|ACEA_EMENI Isocitrate lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuD PE=1 SV=3 77 208 2.0E-13
sp|Q2IXI7|OADC_RHOP2 Oxaloacetate decarboxylase OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_2368 PE=3 SV=1 55 259 2.0E-13
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 110 208 3.0E-13
sp|Q9C124|ACEA_PICPA Isocitrate lyase OS=Komagataella pastoris GN=ICL1 PE=3 SV=1 124 208 3.0E-13
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 118 208 4.0E-13
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 121 208 4.0E-13
sp|P25248|ACEA_BRANA Isocitrate lyase OS=Brassica napus PE=2 SV=1 127 209 5.0E-13
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 127 209 6.0E-13
sp|P33182|PEPM_TETPY Phosphoenolpyruvate phosphomutase OS=Tetrahymena pyriformis GN=PEPM PE=1 SV=1 51 298 6.0E-13
sp|P49297|ACEA_SOLLC Isocitrate lyase OS=Solanum lycopersicum PE=2 SV=1 127 209 7.0E-13
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 118 208 8.0E-13
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 48 208 1.0E-12
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 110 208 1.0E-12
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 127 303 1.0E-12
sp|Q6Z6M4|ACEA_ORYSJ Isocitrate lyase OS=Oryza sativa subsp. japonica GN=ICL PE=1 SV=1 127 209 1.0E-12
sp|P93110|ACEA_CUCMA Isocitrate lyase OS=Cucurbita maxima PE=2 SV=1 127 209 2.0E-12
sp|O86937|PEPM_STRVR Phosphoenolpyruvate phosphomutase OS=Streptomyces viridochromogenes GN=ppm PE=3 SV=1 46 325 2.0E-12
sp|P17069|ACEA_GOSHI Isocitrate lyase OS=Gossypium hirsutum PE=2 SV=1 127 209 2.0E-12
sp|Q3KCJ2|OADC2_PSEPF Oxaloacetate decarboxylase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_2772 PE=3 SV=1 53 299 2.0E-12
sp|Q8NJ72|ACEA_KLULA Isocitrate lyase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ICL1 PE=2 SV=1 127 208 2.0E-12
sp|P49296|ACEA_CUCSA Isocitrate lyase OS=Cucumis sativus PE=3 SV=1 127 209 3.0E-12
sp|Q9SE26|ACEA_DENCR Isocitrate lyase OS=Dendrobium crumenatum GN=ICL PE=2 SV=1 127 209 3.0E-12
sp|Q9P8Q7|ACEA_CANAX Isocitrate lyase OS=Candida albicans GN=ICL1 PE=3 SV=1 124 208 4.0E-12
sp|Q8VJU4|ACEA2_MYCTO Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl2 PE=1 SV=2 39 208 4.0E-12
sp|H8F3R6|ACEA2_MYCTE Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=aceAb PE=1 SV=1 39 208 4.0E-12
sp|Q7TZA8|ACEA2_MYCBO Isocitrate lyase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aceA PE=3 SV=1 39 208 4.0E-12
sp|P45456|ACEA1_SOYBN Isocitrate lyase 1 (Fragment) OS=Glycine max GN=ICL1 PE=2 SV=1 127 208 5.0E-12
sp|P45457|ACEA2_SOYBN Isocitrate lyase 2 (Fragment) OS=Glycine max GN=ICL2 PE=2 SV=1 127 208 5.0E-12
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 127 209 5.0E-12
sp|P20014|ACEA_CANTR Isocitrate lyase OS=Candida tropicalis GN=ICL1 PE=3 SV=1 124 208 7.0E-12
sp|P15479|ACEA_RICCO Isocitrate lyase OS=Ricinus communis PE=2 SV=1 127 208 1.0E-11
sp|P46831|ACEA_MYCLE Isocitrate lyase OS=Mycobacterium leprae (strain TN) GN=aceA PE=3 SV=2 124 208 1.0E-11
sp|O07718|ACEAA_MYCTU Putative isocitrate lyase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAa PE=1 SV=1 39 208 2.0E-11
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 21 208 3.0E-11
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 127 208 4.0E-11
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 49 208 5.0E-11
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 21 208 6.0E-11
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 21 208 6.0E-11
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 127 208 6.0E-11
sp|B1JFP4|OADC2_PSEPW Oxaloacetate decarboxylase 2 OS=Pseudomonas putida (strain W619) GN=PputW619_5152 PE=3 SV=1 52 297 6.0E-11
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 127 208 6.0E-11
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 1 208 2.0E-10
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 62 208 5.0E-10
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 62 208 5.0E-10
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 62 208 5.0E-10
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 62 208 5.0E-10
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 59 208 7.0E-10
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 120 208 1.0E-09
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 127 208 1.0E-09
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 127 208 2.0E-09
sp|Q84G06|PPHA_VARSP Phosphonopyruvate hydrolase OS=Variovorax sp. (strain Pal2) GN=pphA PE=1 SV=1 58 306 2.0E-08
sp|O50078|ACEA_HYPME Isocitrate lyase OS=Hyphomicrobium methylovorum GN=aceA PE=1 SV=1 116 209 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004451 isocitrate lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016833 oxo-acid-lyase activity No
GO:0016830 carbon-carbon lyase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5458
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03830
Ophiocordyceps camponoti-rufipedis Ophun1|3680 (this protein)
Ophiocordyceps kimflemingae Ophio5|1876
Ophiocordyceps subramaniannii Hirsu2|6222

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3680
MSPVAIEPVFSHVLPQRDRVPAYEGSVRPIGSFLSLGHVESAMPEPASGATKLRKMLLETNELIVCPGVYDGLSA
RTAMELGFDAMYMTGAGTTASRLGQPDLSIAQLHEMRENADMIANLDPFGPPLIADMDTGYGGPIMAARTVEQYI
RSGVAGAHLEDQVLTKRCGHLAGKKVVPRDEYYMRIRAAHAARVRMRSDFVLIARTDALQTLGYDECIERLRTAR
DLGADVGLIEGFQSKEQAARAVRDLAPWPLLLNSVENGASPTITVDEARQMGFRIMIFSFACLAPAYRAIRDTLM
LLKTKGIVGTPKDLTPVRLFEVCGLKQAVSVDVEAGGLSFAEGV*
Coding >Ophun1|3680
ATGTCGCCTGTTGCCATCGAACCCGTCTTCAGTCACGTCCTCCCTCAACGGGATCGTGTACCGGCGTACGAGGGG
TCCGTGAGGCCTATTGGTTCTTTTCTGTCACTAGGCCATGTTGAGTCCGCGATGCCGGAGCCCGCATCCGGGGCG
ACCAAGCTTCGAAAGATGCTCTTGGAGACGAACGAGCTCATCGTCTGTCCCGGTGTCTATGACGGCTTGTCAGCA
AGGACCGCCATGGAGCTGGGCTTCGATGCCATGTACATGACCGGTGCTGGAACAACGGCTTCTCGTCTGGGACAG
CCTGATCTCAGCATCGCGCAACTCCACGAGATGCGGGAAAACGCCGACATGATTGCAAACCTGGATCCCTTCGGC
CCTCCGCTGATTGCAGACATGGACACCGGCTACGGAGGCCCCATCATGGCCGCCCGAACGGTGGAGCAGTACATC
CGATCCGGCGTCGCCGGCGCCCATCTAGAAGACCAGGTCCTGACCAAGCGATGCGGCCACCTGGCAGGCAAAAAG
GTGGTGCCGAGGGACGAGTACTACATGCGGATTCGAGCCGCCCACGCGGCGCGCGTACGGATGCGCTCCGACTTT
GTTCTGATCGCACGGACCGACGCGCTGCAGACGCTGGGATACGACGAGTGTATCGAGCGGTTGAGAACGGCGCGG
GATCTTGGCGCTGATGTCGGTCTCATCGAGGGCTTCCAGTCCAAGGAGCAGGCAGCACGGGCAGTCCGCGACCTG
GCTCCCTGGCCACTGCTCCTCAACAGCGTCGAGAACGGAGCCAGCCCAACAATTACCGTCGACGAGGCCCGTCAG
ATGGGCTTCAGAATCATGATCTTCTCCTTTGCCTGCCTTGCGCCCGCCTACCGAGCCATCCGGGATACGCTGATG
CTTCTCAAGACCAAGGGCATCGTCGGTACGCCCAAGGACCTGACGCCGGTACGGTTATTCGAGGTCTGCGGCTTG
AAGCAAGCTGTATCGGTTGACGTTGAGGCGGGGGGGTTGTCGTTCGCTGAAGGCGTTTGA
Transcript >Ophun1|3680
ATGTCGCCTGTTGCCATCGAACCCGTCTTCAGTCACGTCCTCCCTCAACGGGATCGTGTACCGGCGTACGAGGGG
TCCGTGAGGCCTATTGGTTCTTTTCTGTCACTAGGCCATGTTGAGTCCGCGATGCCGGAGCCCGCATCCGGGGCG
ACCAAGCTTCGAAAGATGCTCTTGGAGACGAACGAGCTCATCGTCTGTCCCGGTGTCTATGACGGCTTGTCAGCA
AGGACCGCCATGGAGCTGGGCTTCGATGCCATGTACATGACCGGTGCTGGAACAACGGCTTCTCGTCTGGGACAG
CCTGATCTCAGCATCGCGCAACTCCACGAGATGCGGGAAAACGCCGACATGATTGCAAACCTGGATCCCTTCGGC
CCTCCGCTGATTGCAGACATGGACACCGGCTACGGAGGCCCCATCATGGCCGCCCGAACGGTGGAGCAGTACATC
CGATCCGGCGTCGCCGGCGCCCATCTAGAAGACCAGGTCCTGACCAAGCGATGCGGCCACCTGGCAGGCAAAAAG
GTGGTGCCGAGGGACGAGTACTACATGCGGATTCGAGCCGCCCACGCGGCGCGCGTACGGATGCGCTCCGACTTT
GTTCTGATCGCACGGACCGACGCGCTGCAGACGCTGGGATACGACGAGTGTATCGAGCGGTTGAGAACGGCGCGG
GATCTTGGCGCTGATGTCGGTCTCATCGAGGGCTTCCAGTCCAAGGAGCAGGCAGCACGGGCAGTCCGCGACCTG
GCTCCCTGGCCACTGCTCCTCAACAGCGTCGAGAACGGAGCCAGCCCAACAATTACCGTCGACGAGGCCCGTCAG
ATGGGCTTCAGAATCATGATCTTCTCCTTTGCCTGCCTTGCGCCCGCCTACCGAGCCATCCGGGATACGCTGATG
CTTCTCAAGACCAAGGGCATCGTCGGTACGCCCAAGGACCTGACGCCGGTACGGTTATTCGAGGTCTGCGGCTTG
AAGCAAGCTGTATCGGTTGACGTTGAGGCGGGGGGGTTGTCGTTCGCTGAAGGCGTTTGA
Gene >Ophun1|3680
ATGTCGCCTGTTGCCATCGAACCCGTCTTCAGTCACGTCCTCCCTCAACGGGATCGTGTACCGGCGTACGAGGGG
TCCGTGAGGCCTATTGGTTCTTTTCTGTCACTAGGCCATGTTGAGTCCGCGATGCCGGAGCCCGCATCCGGGGCG
ACCAAGCTTCGAAAGATGCTCTTGGAGACGAACGAGCTCATCGTCTGTCCCGGTGTCTATGACGGCTTGTCAGCA
AGGACCGCCATGGAGCTGGGCTTCGATGCCATGTACATGGTAAGTCAACGGCACGAAATGCCTTCAAGTCTCGCC
AAACTGACGCGACATAGACCGGTGCTGGAACAACGGCTTCTCGTCTGGGACAGCCTGATCTCAGCATCGCGCAAC
TCCACGAGATGCGGGAAAACGCCGACATGATTGCAAACCTGGATCCCTTCGGCCCTCCGCTGATTGCAGACATGG
ACACCGGCTACGGAGGTAAGCGGAATCTGCCCCATCCGATCTGACCGTAACTGATCCCCCCTTTCCCATCAGGCC
CCATCATGGCCGCCCGAACGGTGGAGCAGTACATCCGATCCGGCGTCGCCGGCGCCCATCTAGAAGACCAGGTCC
TGACCAAGCGATGCGGCCACCTGGCAGGCAAAAAGGTGGTGCCGAGGGACGAGTACTACATGCGGATTCGAGCCG
CCCACGCGGCGCGCGTACGGATGCGCTCCGACTTTGTTCTGATCGCACGGACCGACGCGCTGCAGACGCTGGGAT
ACGACGAGTGTATCGAGCGGTTGAGAACGGCGCGGGATCTTGGCGCTGATGTCGGTCTCATCGAGGGCTTCCAGT
CCAAGGAGCAGGCAGCACGGGCAGTCCGCGACCTGGCTCCCTGGCCACTGCTCCTCAACAGCGTCGAGAACGGAG
CCAGCCCAACAATTACCGTCGACGAGGCCCGTCAGATGGGCTTCAGAATCATGATCTTCTCCTTTGCCTGCCTTG
CGCCCGCCTACCGAGCCATCCGGGATACGCTGATGCTTCTCAAGACCAAGGGCATCGTCGGTACGCCCAAGGACC
TGACGCCGGTACGGTTATTCGAGGTCTGCGGCTTGAAGCAAGCTGTATCGGTTGACGTTGAGGCGGGGGGGTTGT
CGTTCGCTGAAGGCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail