Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3666
Gene name
LocationContig_329:4020..5708
Strand+
Gene length (bp)1688
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 4.4E-20 259 475

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SLD2|DGAT1_ARATH Diacylglycerol O-acyltransferase 1 OS=Arabidopsis thaliana GN=DGAT1 PE=1 SV=2 49 496 3.0E-67
sp|Q55BH9|DGAT1_DICDI Diacylglycerol O-acyltransferase 1 OS=Dictyostelium discoideum GN=dgat1 PE=3 SV=2 60 485 1.0E-66
sp|O75907|DGAT1_HUMAN Diacylglycerol O-acyltransferase 1 OS=Homo sapiens GN=DGAT1 PE=1 SV=2 58 484 7.0E-52
sp|Q9Z2A7|DGAT1_MOUSE Diacylglycerol O-acyltransferase 1 OS=Mus musculus GN=Dgat1 PE=1 SV=1 58 484 3.0E-51
sp|Q9ERM3|DGAT1_RAT Diacylglycerol O-acyltransferase 1 OS=Rattus norvegicus GN=Dgat1 PE=2 SV=1 58 484 9.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SLD2|DGAT1_ARATH Diacylglycerol O-acyltransferase 1 OS=Arabidopsis thaliana GN=DGAT1 PE=1 SV=2 49 496 3.0E-67
sp|Q55BH9|DGAT1_DICDI Diacylglycerol O-acyltransferase 1 OS=Dictyostelium discoideum GN=dgat1 PE=3 SV=2 60 485 1.0E-66
sp|O75907|DGAT1_HUMAN Diacylglycerol O-acyltransferase 1 OS=Homo sapiens GN=DGAT1 PE=1 SV=2 58 484 7.0E-52
sp|Q9Z2A7|DGAT1_MOUSE Diacylglycerol O-acyltransferase 1 OS=Mus musculus GN=Dgat1 PE=1 SV=1 58 484 3.0E-51
sp|Q9ERM3|DGAT1_RAT Diacylglycerol O-acyltransferase 1 OS=Rattus norvegicus GN=Dgat1 PE=2 SV=1 58 484 9.0E-51
sp|Q9GMF1|DGAT1_CHLAE Diacylglycerol O-acyltransferase 1 OS=Chlorocebus aethiops GN=DGAT1 PE=2 SV=1 58 484 4.0E-50
sp|Q8MK44|DGAT1_BOVIN Diacylglycerol O-acyltransferase 1 OS=Bos taurus GN=DGAT1 PE=2 SV=2 58 484 4.0E-48
sp|Q876L2|ARE2_SACU7 Sterol O-acyltransferase 2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE2 PE=3 SV=1 245 470 1.0E-31
sp|Q9UU82|AREH2_SCHPO Probable sterol O-acyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are2 PE=1 SV=1 247 471 1.0E-30
sp|P53629|ARE2_YEAST Sterol O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE2 PE=1 SV=1 245 470 4.0E-29
sp|Q10269|AREH1_SCHPO Probable sterol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are1 PE=3 SV=1 247 484 3.0E-26
sp|P84285|ARE2_CANAX Sterol O-acyltransferase 2 OS=Candida albicans GN=ARE2 PE=1 SV=1 213 472 2.0E-24
sp|Q61263|SOAT1_MOUSE Sterol O-acyltransferase 1 OS=Mus musculus GN=Soat1 PE=1 SV=2 243 425 2.0E-24
sp|O70536|SOAT1_RAT Sterol O-acyltransferase 1 OS=Rattus norvegicus GN=Soat1 PE=2 SV=1 252 425 8.0E-24
sp|P35610|SOAT1_HUMAN Sterol O-acyltransferase 1 OS=Homo sapiens GN=SOAT1 PE=1 SV=3 252 425 1.0E-23
sp|O88908|SOAT2_MOUSE Sterol O-acyltransferase 2 OS=Mus musculus GN=Soat2 PE=1 SV=2 252 491 1.0E-23
sp|Q7TQM4|SOAT2_RAT Sterol O-acyltransferase 2 OS=Rattus norvegicus GN=Soat2 PE=2 SV=1 252 491 1.0E-23
sp|O77760|SOAT1_CHLAE Sterol O-acyltransferase 1 OS=Chlorocebus aethiops GN=SOAT1 PE=2 SV=1 252 425 2.0E-23
sp|Q60457|SOAT1_CRIGR Sterol O-acyltransferase 1 OS=Cricetulus griseus GN=SOAT1 PE=2 SV=1 252 425 2.0E-23
sp|O77761|SOAT1_MACFA Sterol O-acyltransferase 1 OS=Macaca fascicularis GN=SOAT1 PE=2 SV=1 252 425 4.0E-23
sp|Q876L3|ARE1_SACU7 Sterol O-acyltransferase 1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE1 PE=3 SV=1 244 468 2.0E-22
sp|O75908|SOAT2_HUMAN Sterol O-acyltransferase 2 OS=Homo sapiens GN=SOAT2 PE=2 SV=1 252 491 2.0E-22
sp|O77759|SOAT2_CHLAE Sterol O-acyltransferase 2 OS=Chlorocebus aethiops GN=SOAT2 PE=2 SV=1 252 491 2.0E-22
sp|P25628|ARE1_YEAST Sterol O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE1 PE=1 SV=1 244 478 4.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 75 94 19
2 115 137 22
3 172 194 22
4 286 308 22
5 332 354 22
6 429 451 22
7 466 488 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3666
MSASTATGVESTKTDTTTRRHIVDDATTSQSSNGTTLETTSPEPRNHVYRHVAAVHRRTRPSCLSHDSNAAPSFI
GFRNLMVIVLVVGNLRLLVENMQKARSRLALVLPLRRQDIIIGGLLYFLIPCHLVAAYLLELAAARQALETRKRM
KPGASGPSEKDKEDFHSTWIVIAWIHGINVTLALVITSAVVYFFVHHPLIGTLTEMHAVIVWLKTASYALTNRDL
RHAYLHPADDHLIPPLYAERPYPRNITIGNLIYFWWAPTLVYQPVYPRTDKIRWLFLVKRLGECFCLSAFIWFAS
FQYAAPVLRNSLDKIASLDIASIFERLLKLSTISLVIWLAGFFALFQSFLNALAEMLRFGDRVFYDDWWNSESLG
AYWRTWNKPVYTYFKRHVYIPLIARGWSSTMASSVVFLASAVLHEILVGVPTHNIIGVAFLGMLLQLPLIHLTAP
LENMKLGKSGKLVGNIIFWVSFTIFGQPFAALMYFYAWQAKYGSVSREMGHKEVNV*
Coding >Ophun1|3666
ATGAGTGCGTCCACGGCGACTGGCGTCGAATCGACGAAGACCGACACAACCACGAGACGTCATATCGTCGACGAC
GCGACAACGTCGCAGTCCTCCAACGGCACCACCCTTGAGACAACCTCGCCCGAGCCTCGAAACCACGTCTATCGT
CATGTCGCTGCTGTTCACCGGCGCACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTCATT
GGCTTCCGCAATCTCATGGTCATTGTTCTGGTCGTCGGTAACTTGCGATTATTGGTCGAGAATATGCAAAAGGCT
CGTTCTCGCCTTGCGCTCGTTCTTCCTCTGCGCCGTCAGGACATCATCATCGGAGGCTTGCTCTACTTTCTGATT
CCCTGTCACCTCGTGGCCGCCTATCTTCTCGAGCTCGCCGCCGCTCGTCAGGCGCTGGAGACGCGTAAACGTATG
AAACCGGGCGCGAGCGGCCCATCGGAGAAGGATAAAGAGGATTTCCACTCGACCTGGATTGTCATTGCGTGGATC
CACGGCATCAACGTGACGCTGGCCCTGGTGATAACGTCGGCCGTCGTCTACTTCTTCGTCCATCATCCGCTCATA
GGCACCCTTACCGAGATGCATGCCGTCATCGTATGGCTCAAGACTGCATCCTACGCCCTGACGAACCGCGACCTC
CGCCACGCCTACCTGCATCCCGCCGACGACCATCTCATCCCGCCGCTGTACGCTGAACGCCCGTATCCGCGAAAC
ATCACAATCGGCAACCTCATCTACTTCTGGTGGGCCCCGACTCTCGTCTACCAGCCCGTCTATCCTCGCACCGAC
AAGATTAGATGGCTGTTTCTCGTCAAGAGGCTCGGCGAGTGCTTCTGTCTCAGCGCCTTCATCTGGTTCGCTAGC
TTCCAGTATGCAGCTCCTGTCCTGCGCAACTCGTTGGATAAGATTGCTTCGCTCGACATTGCCTCCATTTTCGAA
CGGCTACTGAAGCTGTCGACCATCTCGCTCGTCATCTGGCTCGCCGGTTTCTTCGCCCTCTTCCAGTCTTTCCTC
AATGCTCTTGCCGAGATGCTGCGCTTCGGCGACCGGGTTTTTTACGACGACTGGTGGAACAGCGAGAGCTTGGGC
GCCTACTGGAGGACGTGGAACAAGCCCGTCTACACCTACTTTAAACGACACGTTTACATCCCCCTGATTGCTCGT
GGCTGGAGCTCGACCATGGCTAGCTCCGTCGTCTTCTTGGCGTCCGCCGTCCTACACGAGATTCTCGTCGGCGTG
CCTACGCACAACATCATCGGGGTCGCCTTTCTCGGCATGCTCCTCCAGCTTCCCCTGATTCACTTGACGGCGCCG
CTGGAGAACATGAAGCTTGGCAAGAGCGGCAAGCTTGTTGGCAACATCATATTCTGGGTATCTTTTACCATCTTC
GGGCAGCCTTTCGCGGCGTTGATGTATTTCTACGCTTGGCAGGCCAAGTACGGCAGCGTAAGCCGAGAGATGGGG
CACAAAGAGGTCAATGTGTAA
Transcript >Ophun1|3666
ATGAGTGCGTCCACGGCGACTGGCGTCGAATCGACGAAGACCGACACAACCACGAGACGTCATATCGTCGACGAC
GCGACAACGTCGCAGTCCTCCAACGGCACCACCCTTGAGACAACCTCGCCCGAGCCTCGAAACCACGTCTATCGT
CATGTCGCTGCTGTTCACCGGCGCACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTCATT
GGCTTCCGCAATCTCATGGTCATTGTTCTGGTCGTCGGTAACTTGCGATTATTGGTCGAGAATATGCAAAAGGCT
CGTTCTCGCCTTGCGCTCGTTCTTCCTCTGCGCCGTCAGGACATCATCATCGGAGGCTTGCTCTACTTTCTGATT
CCCTGTCACCTCGTGGCCGCCTATCTTCTCGAGCTCGCCGCCGCTCGTCAGGCGCTGGAGACGCGTAAACGTATG
AAACCGGGCGCGAGCGGCCCATCGGAGAAGGATAAAGAGGATTTCCACTCGACCTGGATTGTCATTGCGTGGATC
CACGGCATCAACGTGACGCTGGCCCTGGTGATAACGTCGGCCGTCGTCTACTTCTTCGTCCATCATCCGCTCATA
GGCACCCTTACCGAGATGCATGCCGTCATCGTATGGCTCAAGACTGCATCCTACGCCCTGACGAACCGCGACCTC
CGCCACGCCTACCTGCATCCCGCCGACGACCATCTCATCCCGCCGCTGTACGCTGAACGCCCGTATCCGCGAAAC
ATCACAATCGGCAACCTCATCTACTTCTGGTGGGCCCCGACTCTCGTCTACCAGCCCGTCTATCCTCGCACCGAC
AAGATTAGATGGCTGTTTCTCGTCAAGAGGCTCGGCGAGTGCTTCTGTCTCAGCGCCTTCATCTGGTTCGCTAGC
TTCCAGTATGCAGCTCCTGTCCTGCGCAACTCGTTGGATAAGATTGCTTCGCTCGACATTGCCTCCATTTTCGAA
CGGCTACTGAAGCTGTCGACCATCTCGCTCGTCATCTGGCTCGCCGGTTTCTTCGCCCTCTTCCAGTCTTTCCTC
AATGCTCTTGCCGAGATGCTGCGCTTCGGCGACCGGGTTTTTTACGACGACTGGTGGAACAGCGAGAGCTTGGGC
GCCTACTGGAGGACGTGGAACAAGCCCGTCTACACCTACTTTAAACGACACGTTTACATCCCCCTGATTGCTCGT
GGCTGGAGCTCGACCATGGCTAGCTCCGTCGTCTTCTTGGCGTCCGCCGTCCTACACGAGATTCTCGTCGGCGTG
CCTACGCACAACATCATCGGGGTCGCCTTTCTCGGCATGCTCCTCCAGCTTCCCCTGATTCACTTGACGGCGCCG
CTGGAGAACATGAAGCTTGGCAAGAGCGGCAAGCTTGTTGGCAACATCATATTCTGGGTATCTTTTACCATCTTC
GGGCAGCCTTTCGCGGCGTTGATGTATTTCTACGCTTGGCAGGCCAAGTACGGCAGCGTAAGCCGAGAGATGGGG
CACAAAGAGGTCAATGTGTAA
Gene >Ophun1|3666
ATGAGTGCGTCCACGGCGACTGGCGTCGAATCGACGAAGACCGACACAACCACGAGACGTCATATCGTCGACGAC
GCGACAACGTCGCAGTCCTCCAACGGCACCACCCTTGAGACAACCTCGCCCGAGCCTCGAAACCACGTCTATCGT
CATGTCGCTGCTGTTCACCGGCGCACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTCATT
GGCTTCCGCAATCTCATGGTCATTGTTCTGGGTAAGCGATGTCGCGGCCGGCGACACCCGAGTGCCTCGTCGCTA
ACGGTCGTCAGTCGTCGGTAACTTGCGATTATTGGTCGAGAATATGCAAAAGGCTCGTTCTCGCCTTGCGCTCGT
TCTTCCTCTGCGGTGGCTGACCTCGGCCGTAGTACGGCGTCTTGATTTGCTTTAGGTGCCATGCATACAGCCGTC
AGGACATCATCATCGGAGGCTTGCTCTACTTTCTGATTCCCTGTCACCTCGTGGCCGCCTATCTTCTCGAGCTCG
CCGCCGCTCGTCAGGCGCTGGAGACGCGTAAACGTATGAAACCGGGCGCGAGCGGCCCATCGGAGAAGGATAAAG
AGGATTTCCACTCGACCTGGATTGTCATTGCGTGGATCCACGGCATCAACGTGACGCTGGCCCTGGTGATAACGT
CGGCCGTCGTCTACTTCTTCGTCCATCATCCGCTCATAGGCACCCTTACCGAGATGCATGCCGTCATCGTATGGC
TCAAGACTGCATCCTACGCCCTGACGAACCGCGACCTCCGCCACGCCTACCTGCATCCCGCCGACGACCATCTCA
TCCCGCCGCTGTACGCTGAACGCCCGTATCCGCGAAACATCACAATCGGCAACCTCATCTACTTCTGGTGGGCCC
CGACTCTCGTCTACCAGCCCGTCTATCCTCGCACCGACAAGATTAGATGGCTGTTTCTCGTCAAGAGGCTCGGCG
AGTGCTTCTGTCTCAGCGCCTTCATCTGGTTCGCTAGCTTCCAGTATGCAGCTCCTGTCCTGCGCAACTCGTTGG
ATAAGATTGCTTCGCTCGACATTGCCTCCATTTTCGAACGGCTACTGAAGCTGTCGACCATCTCGCTCGTCATCT
GGCTCGCCGGTTTCTTCGCCCTCTTCCAGTCTTTCCTCAATGCTCTTGCCGAGATGCTGCGCTTCGGCGACCGGG
TTTTTTACGACGACTGGTGGAACAGCGAGAGCTTGGGCGCCTACTGGAGGACGTGGAACAAGCCCGTCTACACCT
ACTTTAAACGACACGTTTACATCCCCCTGATTGCTCGTGGCTGGAGCTCGACCATGGCTAGCTCCGTCGTCTTCT
TGGCGTCCGCCGTCCTACACGAGATTCTCGTCGGCGTGCCTACGCACAACATCATCGGTGAGTCCAGCATTGTTC
CGGTGCATACCGGAAGCTGACTTTGTACAATCATAGGGGTCGCCTTTCTCGGCATGCTCCTCCAGCTTCCCCTGA
TTCACTTGACGGCGCCGCTGGAGAACATGAAGCTTGGCAAGAGCGGCAAGCTTGTTGGCAACATCATATTCTGGG
TATCTTTTACCATCTTCGGGCAGCCTTTCGCGGCGTTGATGTATTTCTACGCTTGGCAGGCCAAGTACGGCAGCG
TAAGCCGAGAGATGGGGCACAAAGAGGTCAATGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail