Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3656
Gene name
LocationContig_327:14385..15487
Strand-
Gene length (bp)1102
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 2.4E-16 161 270

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A2PZA5|FUSS_PHOAM Fusicoccadiene synthase OS=Phomopsis amygdali GN=PaFS PE=1 SV=1 24 314 3.0E-13
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 125 314 8.0E-13
sp|C9K2Q3|FUSS_ALTBR Fusicoccadiene synthase OS=Alternaria brassicicola GN=bsc8 PE=1 SV=1 70 314 1.0E-11
sp|Q9UR08|ARIS_ASPTE Aristolochene synthase OS=Aspergillus terreus GN=Ari1 PE=1 SV=1 174 316 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3656
MGSLPNASFYDKLDASRVPDHFSRYPVAISVAAAKVEAALDRVDIEASEHNTRERRRAVIRHSNSHGNAFAICHC
SAEPRRLVLLSSIVEVLWIHDGNQPCFSKLACHEHDVLAQVIRLDIQPSDRFENIRQRTLAPLLRQAIDIDPEAG
PVLVEVLRDYIKTFDDRNHDFSTMAEYMPFRINHCGYWLSSYFIRWGVGMTMSPEDYSSIREYDIAMGNILGLTN
DYFSWNVEKSQPTDRIRNGVRVLMKEHGINDDAAKTLLLGIIVEQETKAARLKEERLKKPVSREVELYMEDIELF
ASGSCYWHATAPRYKIFE*
Coding >Ophun1|3656
ATGGGCAGCCTCCCAAATGCCTCCTTCTACGACAAGCTTGATGCCTCTCGTGTCCCAGATCACTTCTCTCGATAT
CCTGTCGCCATCAGCGTCGCAGCGGCCAAGGTCGAGGCCGCCCTTGACCGTGTTGACATCGAAGCCTCTGAACAT
AACACGAGAGAGCGGCGTCGGGCAGTGATCCGCCATTCGAATTCTCATGGCAATGCCTTTGCCATCTGTCATTGC
TCTGCTGAGCCTAGAAGGCTGGTCCTTCTGTCCAGCATAGTCGAGGTCCTGTGGATTCACGATGGTAATCAGCCC
TGTTTCTCAAAGCTGGCCTGCCACGAGCACGACGTACTTGCCCAAGTTATTCGACTAGATATCCAGCCGTCGGAC
CGTTTCGAAAACATCCGACAGCGTACTTTGGCTCCCCTTCTTAGGCAAGCCATCGACATAGATCCAGAGGCGGGG
CCCGTCCTCGTGGAAGTGCTTCGAGATTATATAAAGACGTTTGACGATCGAAACCATGATTTCTCTACCATGGCC
GAGTACATGCCGTTCCGCATAAATCATTGCGGATACTGGTTGTCATCATACTTTATCCGCTGGGGCGTGGGAATG
ACCATGAGTCCCGAGGATTACAGCTCTATCCGCGAGTACGACATTGCCATGGGCAACATCCTCGGTTTGACCAAT
GATTACTTTAGCTGGAATGTTGAAAAGTCCCAGCCGACGGACCGGATAAGGAATGGCGTCAGAGTGTTGATGAAA
GAGCATGGTATCAACGACGATGCCGCCAAGACGCTGCTCCTGGGCATCATCGTCGAACAAGAGACCAAGGCTGCC
AGGCTCAAGGAGGAACGCTTGAAGAAGCCTGTTTCGAGGGAGGTTGAGTTGTATATGGAGGATATTGAGCTGTTT
GCCAGTGGCAGCTGCTACTGGCACGCGACGGCGCCGCGGTACAAGATTTTCGAGTGA
Transcript >Ophun1|3656
ATGGGCAGCCTCCCAAATGCCTCCTTCTACGACAAGCTTGATGCCTCTCGTGTCCCAGATCACTTCTCTCGATAT
CCTGTCGCCATCAGCGTCGCAGCGGCCAAGGTCGAGGCCGCCCTTGACCGTGTTGACATCGAAGCCTCTGAACAT
AACACGAGAGAGCGGCGTCGGGCAGTGATCCGCCATTCGAATTCTCATGGCAATGCCTTTGCCATCTGTCATTGC
TCTGCTGAGCCTAGAAGGCTGGTCCTTCTGTCCAGCATAGTCGAGGTCCTGTGGATTCACGATGGTAATCAGCCC
TGTTTCTCAAAGCTGGCCTGCCACGAGCACGACGTACTTGCCCAAGTTATTCGACTAGATATCCAGCCGTCGGAC
CGTTTCGAAAACATCCGACAGCGTACTTTGGCTCCCCTTCTTAGGCAAGCCATCGACATAGATCCAGAGGCGGGG
CCCGTCCTCGTGGAAGTGCTTCGAGATTATATAAAGACGTTTGACGATCGAAACCATGATTTCTCTACCATGGCC
GAGTACATGCCGTTCCGCATAAATCATTGCGGATACTGGTTGTCATCATACTTTATCCGCTGGGGCGTGGGAATG
ACCATGAGTCCCGAGGATTACAGCTCTATCCGCGAGTACGACATTGCCATGGGCAACATCCTCGGTTTGACCAAT
GATTACTTTAGCTGGAATGTTGAAAAGTCCCAGCCGACGGACCGGATAAGGAATGGCGTCAGAGTGTTGATGAAA
GAGCATGGTATCAACGACGATGCCGCCAAGACGCTGCTCCTGGGCATCATCGTCGAACAAGAGACCAAGGCTGCC
AGGCTCAAGGAGGAACGCTTGAAGAAGCCTGTTTCGAGGGAGGTTGAGTTGTATATGGAGGATATTGAGCTGTTT
GCCAGTGGCAGCTGCTACTGGCACGCGACGGCGCCGCGGTACAAGATTTTCGAGTGA
Gene >Ophun1|3656
ATGGGCAGCCTCCCAAATGCCTCCTTCTACGACAAGCTTGATGCCTCTCGTGTCCCAGATCACTTCTCTCGATAT
CCTGTCGCCATCAGCGTCGCAGCGGCCAAGGTCGAGGCCGCCCTTGACCGTGTTGACATCGAAGCCTCTGAACAT
AACACGAGAGAGCGGCGTCGGGCAGTGATCCGCCATTCGAATTCTCATGGCAATGCCTTTGCCATCTGTCATTGC
TCTGCTGAGCCTAGAAGGCTGGTCCTTCTGTCCAGCATAGTCGAGGTCCTGTGGATTCACGATGGTAATCAGCCC
TGTTTCTCAAAGCTGGTCAACGACTAACTTCTTCTTTAGACGTGGCGGAAGAACTCCATCACAATCAAGTTTGCT
GACGACGTTCATCACATATGGAACTCTACTGATCTGTTCAGGCCTGCCACGAGCACGACGTACTTGCCCAAGTTA
TTCGACTAGATATCCAGCCGTCGGACCGTTTCGAAAACATCCGACAGCGTACTTTGGCTCCCCTTCTTAGGCAAG
CCATCGACATAGATCCAGAGGCGGGGCCCGTCCTCGTGGAAGTGCTTCGAGATTATATAAAGACGTTTGACGATC
GAAACCATGATTTCTCTACCATGGCCGAGTACATGCCGTTCCGCATAAATCATTGCGGATACTGGTGCGTTTGAA
GCCTGCGAGTAACGGACGAGCTGACGATACTAGGTTGTCATCATACTTTATCCGCTGGGGCGTGGGAATGACCAT
GAGTCCCGAGGATTACAGCTCTATCCGCGAGTACGACATTGCCATGGGCAACATCCTCGGTTTGACCAATGATTA
CTTTAGCTGGAATGTTGAAAAGTCCCAGCCGACGGACCGGATAAGGAATGGCGTCAGAGTGTTGATGAAAGAGCA
TGGTATCAACGACGATGCCGCCAAGACGCTGCTCCTGGGCATCATCGTCGAACAAGAGACCAAGGCTGCCAGGCT
CAAGGAGGAACGCTTGAAGAAGCCTGTTTCGAGGGAGGTTGAGTTGTATATGGAGGATATTGAGCTGTTTGCCAG
TGGCAGCTGCTACTGGCACGCGACGGCGCCGCGGTACAAGATTTTCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail