Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3650
Gene name
LocationContig_327:1930..3283
Strand+
Gene length (bp)1353
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13695|YEN1_SCHPO Uncharacterized serine-rich protein C11G7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11G7.01 PE=4 SV=1 219 298 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 219 241 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3650
MAPEPEPDINGANRSESFQDKRPSRLADLNMSVRTSQASTPVAESASTPSPDRAAASSAAAPPAAPSSSTPPSPP
PAASPSPPPAPSPASSSSSSEPLPTQQAPAPVPSSSSSPTPPPQHAVTTTPSPSPTPSSSSSPPAAVVPSSSSQQ
PEASSTVVVVTSSSVATSVQVVTSTKTRSPVGGLSSSTPTSSSPSSTSSAAAAIEPPSSATGLTQASKVAIGVVV
PIAAIAFLAIVGLFWWKKRRARQETEEQRRKEVEDYSYNPNADPTMPAVGHTVEHAYEAKDDGGYRGWGSTATTT
GSGRGRKASTTMSGGAAGTYSDPASPVRANMSDARSGEPLVDGSSMHEGEILGAMGPSAANNRGGDMRRGPSNAS
SSYSAAARSDGSDGAMYGNGAAGYYEQCGQNPYEQRPNEQGGGQAVIRDNPARRNTRIENSSHYPQQSAGIAQNF
*
Coding >Ophun1|3650
ATGGCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGTCATTCCAGGACAAGAGGCCCTCTCGT
CTCGCCGACTTGAACATGTCGGTTCGCACGAGCCAGGCCTCGACGCCCGTCGCTGAGAGCGCCTCGACGCCCTCG
CCTGATCGTGCCGCTGCTTCTTCGGCCGCAGCTCCTCCTGCTGCCCCGTCATCGTCCACCCCCCCGAGTCCACCG
CCCGCCGCCAGTCCCAGCCCTCCACCCGCTCCTTCGCCCGCCAGCTCATCGTCGTCGTCGGAACCTTTGCCCACG
CAACAGGCTCCGGCTCCCGTTCCTTCGTCCAGCTCGTCTCCGACGCCGCCGCCCCAGCATGCCGTGACAACAACC
CCGAGTCCGTCCCCGACCCCGTCTTCTTCGTCCTCTCCTCCCGCCGCCGTCGTCCCCTCGTCGTCCTCCCAGCAG
CCGGAAGCTTCTTCGACCGTCGTCGTTGTGACTTCCAGCAGTGTGGCCACCAGCGTACAGGTGGTGACATCGACC
AAGACACGTTCCCCCGTCGGCGGGCTGTCATCGTCGACGCCGACGTCGTCTTCGCCCTCGTCCACCTCTTCCGCC
GCCGCCGCCATCGAGCCCCCCAGCTCGGCCACAGGCCTCACACAGGCGTCAAAGGTGGCCATTGGCGTCGTGGTG
CCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGGGCGCGTCAGGAGACC
GAGGAACAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCCGACCCGACCATGCCAGCCGTCGGC
CACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGCTACCGCGGCTGGGGCTCGACGGCCACCACGACG
GGATCCGGCAGGGGGCGCAAGGCCTCGACCACCATGTCCGGGGGCGCCGCCGGCACCTACTCGGACCCGGCATCG
CCTGTGCGGGCCAACATGTCGGACGCTCGGTCGGGCGAGCCGCTCGTGGACGGCTCGTCGATGCATGAGGGCGAG
ATCCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGCCCGTCCAACGCCTCT
TCCTCGTACAGCGCGGCCGCCAGGTCTGACGGTTCCGACGGCGCCATGTACGGCAACGGAGCGGCCGGCTACTAC
GAGCAGTGCGGCCAGAACCCCTACGAGCAGCGGCCGAACGAACAGGGCGGTGGCCAGGCCGTCATCCGTGATAAT
CCGGCCCGACGCAACACGCGCATCGAGAACTCGTCTCACTACCCGCAGCAGAGTGCTGGCATTGCTCAGAACTTT
TGA
Transcript >Ophun1|3650
ATGGCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGTCATTCCAGGACAAGAGGCCCTCTCGT
CTCGCCGACTTGAACATGTCGGTTCGCACGAGCCAGGCCTCGACGCCCGTCGCTGAGAGCGCCTCGACGCCCTCG
CCTGATCGTGCCGCTGCTTCTTCGGCCGCAGCTCCTCCTGCTGCCCCGTCATCGTCCACCCCCCCGAGTCCACCG
CCCGCCGCCAGTCCCAGCCCTCCACCCGCTCCTTCGCCCGCCAGCTCATCGTCGTCGTCGGAACCTTTGCCCACG
CAACAGGCTCCGGCTCCCGTTCCTTCGTCCAGCTCGTCTCCGACGCCGCCGCCCCAGCATGCCGTGACAACAACC
CCGAGTCCGTCCCCGACCCCGTCTTCTTCGTCCTCTCCTCCCGCCGCCGTCGTCCCCTCGTCGTCCTCCCAGCAG
CCGGAAGCTTCTTCGACCGTCGTCGTTGTGACTTCCAGCAGTGTGGCCACCAGCGTACAGGTGGTGACATCGACC
AAGACACGTTCCCCCGTCGGCGGGCTGTCATCGTCGACGCCGACGTCGTCTTCGCCCTCGTCCACCTCTTCCGCC
GCCGCCGCCATCGAGCCCCCCAGCTCGGCCACAGGCCTCACACAGGCGTCAAAGGTGGCCATTGGCGTCGTGGTG
CCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGGGCGCGTCAGGAGACC
GAGGAACAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCCGACCCGACCATGCCAGCCGTCGGC
CACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGCTACCGCGGCTGGGGCTCGACGGCCACCACGACG
GGATCCGGCAGGGGGCGCAAGGCCTCGACCACCATGTCCGGGGGCGCCGCCGGCACCTACTCGGACCCGGCATCG
CCTGTGCGGGCCAACATGTCGGACGCTCGGTCGGGCGAGCCGCTCGTGGACGGCTCGTCGATGCATGAGGGCGAG
ATCCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGCCCGTCCAACGCCTCT
TCCTCGTACAGCGCGGCCGCCAGGTCTGACGGTTCCGACGGCGCCATGTACGGCAACGGAGCGGCCGGCTACTAC
GAGCAGTGCGGCCAGAACCCCTACGAGCAGCGGCCGAACGAACAGGGCGGTGGCCAGGCCGTCATCCGTGATAAT
CCGGCCCGACGCAACACGCGCATCGAGAACTCGTCTCACTACCCGCAGCAGAGTGCTGGCATTGCTCAGAACTTT
TGA
Gene >Ophun1|3650
ATGGCACCCGAGCCGGAGCCGGACATCAATGGCGCTAACAGGAGTGAGTCATTCCAGGACAAGAGGCCCTCTCGT
CTCGCCGACTTGAACATGTCGGTTCGCACGAGCCAGGCCTCGACGCCCGTCGCTGAGAGCGCCTCGACGCCCTCG
CCTGATCGTGCCGCTGCTTCTTCGGCCGCAGCTCCTCCTGCTGCCCCGTCATCGTCCACCCCCCCGAGTCCACCG
CCCGCCGCCAGTCCCAGCCCTCCACCCGCTCCTTCGCCCGCCAGCTCATCGTCGTCGTCGGAACCTTTGCCCACG
CAACAGGCTCCGGCTCCCGTTCCTTCGTCCAGCTCGTCTCCGACGCCGCCGCCCCAGCATGCCGTGACAACAACC
CCGAGTCCGTCCCCGACCCCGTCTTCTTCGTCCTCTCCTCCCGCCGCCGTCGTCCCCTCGTCGTCCTCCCAGCAG
CCGGAAGCTTCTTCGACCGTCGTCGTTGTGACTTCCAGCAGTGTGGCCACCAGCGTACAGGTGGTGACATCGACC
AAGACACGTTCCCCCGTCGGCGGGCTGTCATCGTCGACGCCGACGTCGTCTTCGCCCTCGTCCACCTCTTCCGCC
GCCGCCGCCATCGAGCCCCCCAGCTCGGCCACAGGCCTCACACAGGCGTCAAAGGTGGCCATTGGCGTCGTGGTG
CCCATCGCCGCCATCGCCTTTCTAGCCATCGTCGGTCTTTTCTGGTGGAAGAAGCGGAGGGCGCGTCAGGAGACC
GAGGAACAACGCCGTAAGGAGGTCGAGGATTACTCGTACAACCCCAACGCCGACCCGACCATGCCAGCCGTCGGC
CACACGGTCGAGCACGCCTACGAGGCCAAGGACGACGGCGGCTACCGCGGCTGGGGCTCGACGGCCACCACGACG
GGATCCGGCAGGGGGCGCAAGGCCTCGACCACCATGTCCGGGGGCGCCGCCGGCACCTACTCGGACCCGGCATCG
CCTGTGCGGGCCAACATGTCGGACGCTCGGTCGGGCGAGCCGCTCGTGGACGGCTCGTCGATGCATGAGGGCGAG
ATCCTGGGCGCCATGGGCCCGTCGGCGGCCAATAACCGCGGCGGCGACATGCGCAGGGGCCCGTCCAACGCCTCT
TCCTCGTACAGCGCGGCCGCCAGGTCTGACGGTTCCGACGGCGCCATGTACGGCAACGGAGCGGCCGGCTACTAC
GAGCAGTGCGGCCAGAACCCCTACGAGCAGCGGCCGAACGAACAGGGCGGTGGCCAGGCCGTCATCCGTGATAAT
CCGGCCCGACGCAACACGCGCATCGAGAACTCGTCTCACTACCCGCAGCAGAGTGCTGGCATTGCTCAGAACTTT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail