Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3645
Gene name
LocationContig_326:3214..4028
Strand+
Gene length (bp)814
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02037 SAP SAP domain 6.5E-12 4 37
PF18592 Tho1_MOS11_C Tho1/MOS11 C-terminal domain 3.3E-11 130 165

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74871|YCW3_SCHPO Uncharacterized protein C31H12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC31H12.03c PE=1 SV=1 1 255 2.0E-18
sp|P40040|THO1_YEAST Protein THO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THO1 PE=1 SV=1 1 170 6.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2566
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5127
Ophiocordyceps australis map64 (Brazil) OphauB2|4263
Ophiocordyceps camponoti-floridani Ophcf2|02236
Ophiocordyceps camponoti-rufipedis Ophun1|3645 (this protein)
Ophiocordyceps kimflemingae Ophio5|1315
Ophiocordyceps subramaniannii Hirsu2|382

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3645
MTDYANLKVPELKRLLAEKKLPQTGNKADLIARLQENDGKHATKADATPATVKEPAKGDGAKPDGEATKLKATES
QPVAENQQQKAKADEKPAPAPAKANATESDDQADEAAKPASEESPQSFALGLSTTAADAEAKKRVDRAKRFGIEE
DDEFKKRAERAKRFGVDENTIASSLDSALPERATKRARGRDADDDNPRDGKRQQVDRRGERRSTRQTRNGGATRD
TRAARKGGSVLDDPKEKAKADKRAARFAAA*
Coding >Ophun1|3645
ATGACCGACTACGCGAATCTCAAGGTTCCAGAGCTCAAGAGGCTTCTAGCCGAGAAGAAGCTGCCGCAGACGGGC
AACAAGGCCGATCTAATTGCTCGTCTACAGGAGAACGATGGGAAGCACGCGACGAAGGCGGACGCGACTCCTGCC
ACCGTCAAGGAGCCTGCAAAGGGCGACGGTGCGAAGCCTGACGGCGAGGCGACGAAGCTCAAAGCGACCGAGTCG
CAGCCTGTCGCCGAAAACCAGCAGCAAAAGGCAAAGGCCGACGAGAAGCCCGCTCCCGCTCCAGCCAAGGCAAAT
GCCACCGAGAGTGATGACCAAGCCGATGAGGCTGCCAAACCTGCCTCGGAAGAATCTCCGCAGTCCTTCGCTCTA
GGCCTCTCTACCACCGCCGCAGACGCCGAGGCCAAGAAGCGCGTCGATCGAGCCAAGCGCTTCGGCATTGAAGAA
GACGACGAGTTCAAGAAGCGCGCTGAACGGGCCAAGCGATTCGGCGTCGACGAAAATACCATTGCGTCGAGCCTC
GACTCTGCCCTTCCCGAACGAGCTACCAAGCGCGCTCGCGGCCGTGACGCAGACGACGACAATCCGCGCGACGGG
AAACGCCAGCAGGTTGATCGACGGGGCGAGCGGCGCTCGACTCGCCAGACGCGCAACGGCGGAGCGACGCGCGAT
ACCAGAGCGGCTCGCAAAGGGGGCAGCGTCTTGGATGATCCCAAGGAGAAAGCCAAGGCGGACAAGCGGGCGGCT
CGGTTTGCCGCCGCCTAG
Transcript >Ophun1|3645
ATGACCGACTACGCGAATCTCAAGGTTCCAGAGCTCAAGAGGCTTCTAGCCGAGAAGAAGCTGCCGCAGACGGGC
AACAAGGCCGATCTAATTGCTCGTCTACAGGAGAACGATGGGAAGCACGCGACGAAGGCGGACGCGACTCCTGCC
ACCGTCAAGGAGCCTGCAAAGGGCGACGGTGCGAAGCCTGACGGCGAGGCGACGAAGCTCAAAGCGACCGAGTCG
CAGCCTGTCGCCGAAAACCAGCAGCAAAAGGCAAAGGCCGACGAGAAGCCCGCTCCCGCTCCAGCCAAGGCAAAT
GCCACCGAGAGTGATGACCAAGCCGATGAGGCTGCCAAACCTGCCTCGGAAGAATCTCCGCAGTCCTTCGCTCTA
GGCCTCTCTACCACCGCCGCAGACGCCGAGGCCAAGAAGCGCGTCGATCGAGCCAAGCGCTTCGGCATTGAAGAA
GACGACGAGTTCAAGAAGCGCGCTGAACGGGCCAAGCGATTCGGCGTCGACGAAAATACCATTGCGTCGAGCCTC
GACTCTGCCCTTCCCGAACGAGCTACCAAGCGCGCTCGCGGCCGTGACGCAGACGACGACAATCCGCGCGACGGG
AAACGCCAGCAGGTTGATCGACGGGGCGAGCGGCGCTCGACTCGCCAGACGCGCAACGGCGGAGCGACGCGCGAT
ACCAGAGCGGCTCGCAAAGGGGGCAGCGTCTTGGATGATCCCAAGGAGAAAGCCAAGGCGGACAAGCGGGCGGCT
CGGTTTGCCGCCGCCTAG
Gene >Ophun1|3645
ATGACCGACTACGCGAATCTCAAGGTTCCAGAGCTCAAGAGGCTTCTAGCCGAGAAGAAGCTGCCGCAGACGGGC
AACAAGGCCGATCTAATTGCTCGTCTACAGGAGAACGATGGGAAGCACGCGACGAAGGCGGACGCGACTCCTGCC
AGTGAGTGCTGCGCTTCCATTACTCTCGCAATTGCTAACAGGAGTAGCCGTCAAGGAGCCTGCAAAGGGCGACGG
TGCGAAGCCTGACGGCGAGGCGACGAAGCTCAAAGCGACCGAGTCGCAGCCTGTCGCCGAAAACCAGCAGCAAAA
GGCAAAGGCCGACGAGAAGCCCGCTCCCGCTCCAGCCAAGGCAAATGCCACCGAGAGTGATGACCAAGCCGATGA
GGCTGCCAAACCTGCCTCGGAAGAATCTCCGCAGTCCTTCGCTCTAGGCCTCTCTACCACCGCCGCAGACGCCGA
GGCCAAGAAGCGCGTCGATCGAGCCAAGCGCTTCGGCATTGAAGAAGACGACGAGTTCAAGAAGCGCGCTGAACG
GGCCAAGCGATTCGGCGTCGACGAAAATACCATTGCGTCGAGCCTCGACTCTGCCCTTCCCGAACGAGCTACCAA
GCGCGCTCGCGGCCGTGACGCAGACGACGACAATCCGCGCGACGGGAAACGCCAGCAGGTTGATCGACGGGGCGA
GCGGCGCTCGACTCGCCAGACGCGCAACGGCGGAGCGACGCGCGATACCAGAGCGGCTCGCAAAGGGGGCAGCGT
CTTGGATGATCCCAAGGAGAAAGCCAAGGCGGACAAGCGGGCGGCTCGGTTTGCCGCCGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail