© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|3640 |
| Gene name | |
| Location | Contig_325:12343..15805 |
| Strand | - |
| Gene length (bp) | 3462 |
| Transcript length (bp) | 3462 |
| Coding sequence length (bp) | 3462 |
| Protein length (aa) | 1154 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF13041 | PPR_2 | PPR repeat family | 7.2E-09 | 849 | 898 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 1.0E-03 | 361 | 407 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 1.1E-02 | 833 | 863 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 5.6E-03 | 874 | 913 |
| PF01535 | PPR | PPR repeat | 2.2E-04 | 364 | 392 |
| PF01535 | PPR | PPR repeat | 1.7E-03 | 853 | 882 |
| PF01535 | PPR | PPR repeat | 1.3E-03 | 887 | 913 |
| PF12854 | PPR_1 | PPR repeat | 1.5E-07 | 881 | 913 |
| PF17177 | PPR_long | Pentacotripeptide-repeat region of PRORP | 7.2E-07 | 821 | 966 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 730 | 1145 | 1.0E-71 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 637 | 1130 | 2.0E-21 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 716 | 1120 | 7.0E-21 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 713 | 1130 | 5.0E-20 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 708 | 1140 | 8.0E-20 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 730 | 1145 | 1.0E-71 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 637 | 1130 | 2.0E-21 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 716 | 1120 | 7.0E-21 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 713 | 1130 | 5.0E-20 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 708 | 1140 | 8.0E-20 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 721 | 1124 | 1.0E-19 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 724 | 1126 | 7.0E-19 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 707 | 1136 | 1.0E-18 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 713 | 1136 | 3.0E-18 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 724 | 1130 | 3.0E-18 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 803 | 1130 | 7.0E-18 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 713 | 1144 | 1.0E-17 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 790 | 1097 | 1.0E-17 |
| sp|Q9ZUU3|PP190_ARATH | Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 | 707 | 1143 | 2.0E-17 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 216 | 1131 | 3.0E-17 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 710 | 1130 | 3.0E-17 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 780 | 1136 | 4.0E-17 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 716 | 1098 | 5.0E-17 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 718 | 1130 | 5.0E-17 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 706 | 1022 | 6.0E-17 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 713 | 1140 | 6.0E-17 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 713 | 1136 | 9.0E-17 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 776 | 1140 | 1.0E-16 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 708 | 1126 | 1.0E-16 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 689 | 1100 | 2.0E-16 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 717 | 1147 | 4.0E-16 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 726 | 1106 | 5.0E-16 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 764 | 1130 | 1.0E-15 |
| sp|Q9T0D6|PP306_ARATH | Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 | 735 | 1123 | 1.0E-15 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 721 | 1130 | 2.0E-15 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 713 | 1095 | 2.0E-15 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 714 | 1148 | 3.0E-15 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 730 | 1152 | 4.0E-15 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 834 | 1109 | 5.0E-15 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 713 | 1149 | 5.0E-15 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 717 | 1136 | 6.0E-15 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 716 | 1075 | 6.0E-15 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 707 | 1089 | 6.0E-15 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 708 | 1135 | 7.0E-15 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 713 | 1106 | 7.0E-15 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 652 | 1136 | 8.0E-15 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 713 | 1110 | 8.0E-15 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 779 | 1096 | 9.0E-15 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 713 | 1135 | 9.0E-15 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 846 | 1130 | 1.0E-14 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 710 | 1058 | 1.0E-14 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 336 | 1055 | 1.0E-14 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 715 | 1131 | 2.0E-14 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 715 | 1131 | 2.0E-14 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 715 | 1146 | 2.0E-14 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 716 | 1130 | 2.0E-14 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 713 | 966 | 2.0E-14 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 710 | 1033 | 3.0E-14 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 716 | 1136 | 3.0E-14 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 711 | 1119 | 3.0E-14 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 800 | 1089 | 3.0E-14 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 834 | 1149 | 5.0E-14 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 731 | 1135 | 6.0E-14 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 717 | 1146 | 6.0E-14 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 735 | 1129 | 7.0E-14 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 707 | 1095 | 9.0E-14 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 715 | 1099 | 1.0E-13 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 834 | 1140 | 1.0E-13 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 807 | 1132 | 1.0E-13 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 834 | 1130 | 1.0E-13 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 791 | 1130 | 1.0E-13 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 721 | 1130 | 1.0E-13 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 710 | 937 | 2.0E-13 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 706 | 1152 | 2.0E-13 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 398 | 967 | 2.0E-13 |
| sp|Q84J71|PP161_ARATH | Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 | 713 | 965 | 2.0E-13 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 820 | 1147 | 3.0E-13 |
| sp|Q9ZUA2|PP141_ARATH | Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 | 685 | 1135 | 3.0E-13 |
| sp|Q0WLC6|PP349_ARATH | Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 | 706 | 965 | 4.0E-13 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 761 | 1107 | 5.0E-13 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 713 | 994 | 5.0E-13 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 717 | 956 | 6.0E-13 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 803 | 976 | 6.0E-13 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 680 | 1043 | 7.0E-13 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 834 | 1140 | 7.0E-13 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 781 | 1130 | 8.0E-13 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 724 | 1140 | 1.0E-12 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 833 | 1090 | 1.0E-12 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 721 | 1090 | 1.0E-12 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 713 | 1111 | 1.0E-12 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 834 | 1130 | 2.0E-12 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 839 | 1140 | 2.0E-12 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 716 | 1130 | 2.0E-12 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 807 | 1145 | 2.0E-12 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 707 | 1110 | 2.0E-12 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 713 | 966 | 2.0E-12 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 710 | 1130 | 3.0E-12 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 710 | 1029 | 3.0E-12 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 705 | 1130 | 3.0E-12 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 715 | 1130 | 3.0E-12 |
| sp|Q9SHK2|PPR17_ARATH | Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 | 829 | 1130 | 3.0E-12 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 739 | 1146 | 4.0E-12 |
| sp|Q9ZUE9|PP149_ARATH | Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 | 817 | 1100 | 4.0E-12 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 710 | 965 | 4.0E-12 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 796 | 1110 | 5.0E-12 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 715 | 1149 | 6.0E-12 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 752 | 1140 | 6.0E-12 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 829 | 1090 | 7.0E-12 |
| sp|Q9FNL2|PP418_ARATH | Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 | 713 | 967 | 7.0E-12 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 795 | 1110 | 7.0E-12 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 803 | 1135 | 9.0E-12 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 716 | 966 | 1.0E-11 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 713 | 1106 | 1.0E-11 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 794 | 1130 | 1.0E-11 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 373 | 922 | 1.0E-11 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 831 | 1142 | 1.0E-11 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 661 | 1090 | 1.0E-11 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 714 | 965 | 1.0E-11 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 796 | 1106 | 2.0E-11 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 710 | 1095 | 2.0E-11 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 713 | 1086 | 2.0E-11 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 799 | 1090 | 2.0E-11 |
| sp|Q8RWS8|PP199_ARATH | Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 | 654 | 1060 | 2.0E-11 |
| sp|Q9FFE3|PP388_ARATH | Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 | 835 | 1095 | 2.0E-11 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 706 | 1119 | 2.0E-11 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 714 | 1023 | 2.0E-11 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 711 | 1131 | 3.0E-11 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 831 | 1136 | 3.0E-11 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 711 | 965 | 3.0E-11 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 709 | 1110 | 3.0E-11 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 724 | 1097 | 3.0E-11 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 713 | 1130 | 4.0E-11 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 710 | 1103 | 4.0E-11 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 781 | 1002 | 4.0E-11 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 728 | 966 | 6.0E-11 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 710 | 1099 | 6.0E-11 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 731 | 1029 | 7.0E-11 |
| sp|A3KPF8|PP131_ARATH | Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 | 619 | 1129 | 7.0E-11 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 727 | 1102 | 9.0E-11 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 723 | 912 | 9.0E-11 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 716 | 1144 | 1.0E-10 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 716 | 1060 | 1.0E-10 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 711 | 1130 | 1.0E-10 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 723 | 1037 | 1.0E-10 |
| sp|Q9LKU8|PP401_ARATH | Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 | 693 | 964 | 1.0E-10 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 791 | 1106 | 1.0E-10 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 693 | 1140 | 2.0E-10 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 839 | 1136 | 2.0E-10 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 731 | 966 | 2.0E-10 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 807 | 1130 | 2.0E-10 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 713 | 1029 | 2.0E-10 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 714 | 1050 | 3.0E-10 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 338 | 1023 | 3.0E-10 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 779 | 1130 | 3.0E-10 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 710 | 1136 | 3.0E-10 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 807 | 1101 | 3.0E-10 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 820 | 1143 | 4.0E-10 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 835 | 1130 | 4.0E-10 |
| sp|Q8GZ63|PP397_ARATH | Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 | 716 | 1122 | 4.0E-10 |
| sp|Q9M8M3|PP136_ARATH | Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 | 790 | 1004 | 4.0E-10 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 714 | 966 | 5.0E-10 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 713 | 1106 | 5.0E-10 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 776 | 1130 | 5.0E-10 |
| sp|Q0WKZ3|PP105_ARATH | Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 | 846 | 1091 | 5.0E-10 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 224 | 473 | 6.0E-10 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 710 | 966 | 6.0E-10 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 724 | 1130 | 6.0E-10 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 364 | 965 | 6.0E-10 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 789 | 1136 | 7.0E-10 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 773 | 1001 | 8.0E-10 |
| sp|Q9LSQ2|PP239_ARATH | Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 | 706 | 1029 | 9.0E-10 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 849 | 1130 | 1.0E-09 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 789 | 1063 | 1.0E-09 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 696 | 1140 | 1.0E-09 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 832 | 1127 | 1.0E-09 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 827 | 1132 | 1.0E-09 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 716 | 1060 | 2.0E-09 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 713 | 930 | 2.0E-09 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 802 | 1119 | 2.0E-09 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 779 | 1090 | 2.0E-09 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 790 | 1058 | 2.0E-09 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 713 | 1139 | 2.0E-09 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 713 | 930 | 3.0E-09 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 833 | 1131 | 3.0E-09 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 695 | 1004 | 3.0E-09 |
| sp|Q9ZVX5|PP156_ARATH | Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 | 691 | 1115 | 3.0E-09 |
| sp|P0C896|PP209_ARATH | Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 | 856 | 1126 | 3.0E-09 |
| sp|Q9SAK0|PP132_ARATH | Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 | 792 | 1014 | 3.0E-09 |
| sp|Q84J71|PP161_ARATH | Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 | 710 | 1091 | 4.0E-09 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 731 | 1032 | 4.0E-09 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 714 | 1144 | 6.0E-09 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 790 | 1058 | 6.0E-09 |
| sp|Q9ZVX5|PP156_ARATH | Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 | 721 | 1131 | 6.0E-09 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 838 | 1126 | 6.0E-09 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 795 | 1134 | 8.0E-09 |
| sp|Q0WP85|PP150_ARATH | Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 | 796 | 1047 | 8.0E-09 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 444 | 1086 | 9.0E-09 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 831 | 1130 | 1.0E-08 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 710 | 1002 | 1.0E-08 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 721 | 1076 | 1.0E-08 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 803 | 1086 | 1.0E-08 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 779 | 1144 | 1.0E-08 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 831 | 965 | 1.0E-08 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 854 | 1130 | 1.0E-08 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 710 | 912 | 2.0E-08 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 706 | 965 | 2.0E-08 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 728 | 1133 | 2.0E-08 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 707 | 1004 | 2.0E-08 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 710 | 1127 | 2.0E-08 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 827 | 1110 | 2.0E-08 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 708 | 1100 | 2.0E-08 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 707 | 1006 | 2.0E-08 |
| sp|Q9FRS4|PPR22_ARATH | Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 | 713 | 1002 | 2.0E-08 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 715 | 1006 | 2.0E-08 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 833 | 1132 | 2.0E-08 |
| sp|Q56XR6|PP421_ARATH | Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 | 722 | 913 | 2.0E-08 |
| sp|Q9M8W9|PP211_ARATH | Pentatricopeptide repeat-containing protein At3g04130, mitochondrial OS=Arabidopsis thaliana GN=At3g04130 PE=2 SV=2 | 807 | 914 | 2.0E-08 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 827 | 1133 | 3.0E-08 |
| sp|Q9LFM6|PP375_ARATH | Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 | 795 | 1106 | 3.0E-08 |
| sp|Q9C9U0|PP118_ARATH | Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 | 791 | 1058 | 3.0E-08 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 781 | 965 | 3.0E-08 |
| sp|Q8GYM2|PP393_ARATH | Pentatricopeptide repeat-containing protein At5g18950 OS=Arabidopsis thaliana GN=At5g18950 PE=2 SV=2 | 716 | 901 | 3.0E-08 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 835 | 1140 | 4.0E-08 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 815 | 1093 | 4.0E-08 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 709 | 1000 | 4.0E-08 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 838 | 1136 | 4.0E-08 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 706 | 1041 | 5.0E-08 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 724 | 1141 | 5.0E-08 |
| sp|Q9M316|PP292_ARATH | Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 | 847 | 1135 | 5.0E-08 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 230 | 493 | 6.0E-08 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 776 | 1136 | 6.0E-08 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 711 | 964 | 6.0E-08 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 790 | 1131 | 6.0E-08 |
| sp|Q9LK58|PP225_ARATH | Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1 | 781 | 1002 | 6.0E-08 |
| sp|Q9M1D8|PP288_ARATH | Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 | 768 | 1002 | 6.0E-08 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 709 | 1149 | 7.0E-08 |
| sp|Q9LKU8|PP401_ARATH | Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 | 847 | 1135 | 7.0E-08 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 713 | 965 | 7.0E-08 |
| sp|Q9M316|PP292_ARATH | Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 | 731 | 1148 | 7.0E-08 |
| sp|Q9FND8|PP409_ARATH | Pentatricopeptide repeat-containing protein At5g40400 OS=Arabidopsis thaliana GN=At5g40400 PE=2 SV=1 | 832 | 1126 | 7.0E-08 |
| sp|Q9SZ20|PP339_ARATH | Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 | 835 | 1130 | 7.0E-08 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 707 | 990 | 7.0E-08 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 710 | 898 | 7.0E-08 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 818 | 1130 | 8.0E-08 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 710 | 1092 | 8.0E-08 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 710 | 972 | 8.0E-08 |
| sp|Q9LFQ4|PP383_ARATH | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 | 785 | 965 | 8.0E-08 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 791 | 1096 | 9.0E-08 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 834 | 965 | 9.0E-08 |
| sp|Q9FVX2|PP129_ARATH | Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 | 710 | 1029 | 9.0E-08 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 713 | 912 | 1.0E-07 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 713 | 930 | 1.0E-07 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 703 | 1107 | 1.0E-07 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 707 | 1132 | 1.0E-07 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 706 | 915 | 1.0E-07 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 779 | 1111 | 1.0E-07 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 231 | 912 | 1.0E-07 |
| sp|Q9LSQ2|PP239_ARATH | Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 | 838 | 1136 | 1.0E-07 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 648 | 1046 | 1.0E-07 |
| sp|Q84J46|PP262_ARATH | Pentatricopeptide repeat-containing protein At3g29290 OS=Arabidopsis thaliana GN=EMB2076 PE=2 SV=1 | 721 | 965 | 1.0E-07 |
| sp|Q9SAA6|PPR34_ARATH | Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 | 710 | 1130 | 1.0E-07 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 230 | 502 | 2.0E-07 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 781 | 1089 | 2.0E-07 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 835 | 1135 | 2.0E-07 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 707 | 918 | 3.0E-07 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 710 | 1034 | 3.0E-07 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 713 | 930 | 3.0E-07 |
| sp|Q9LKU8|PP401_ARATH | Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 | 731 | 1148 | 3.0E-07 |
| sp|Q9SF38|PP222_ARATH | Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 | 783 | 961 | 3.0E-07 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 810 | 1004 | 3.0E-07 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 230 | 556 | 4.0E-07 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 847 | 1140 | 4.0E-07 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 724 | 1096 | 5.0E-07 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 835 | 1130 | 5.0E-07 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 731 | 912 | 5.0E-07 |
| sp|Q9FX35|PP117_ARATH | Pentatricopeptide repeat-containing protein At1g73400, mitochondrial OS=Arabidopsis thaliana GN=At1g73400 PE=2 SV=2 | 726 | 975 | 5.0E-07 |
| sp|Q9LEQ7|PP382_ARATH | Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 | 817 | 1137 | 5.0E-07 |
| sp|Q3EAF8|PP294_ARATH | Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 | 817 | 1137 | 5.0E-07 |
| sp|Q9T0D6|PP306_ARATH | Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 | 701 | 964 | 6.0E-07 |
| sp|Q0WKZ3|PP105_ARATH | Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 | 710 | 1060 | 6.0E-07 |
| sp|Q9LIL5|PP233_ARATH | Putative pentatricopeptide repeat-containing protein At3g15200 OS=Arabidopsis thaliana GN=At3g15200 PE=3 SV=1 | 785 | 1029 | 6.0E-07 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 724 | 1139 | 7.0E-07 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 807 | 1131 | 7.0E-07 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 706 | 1096 | 7.0E-07 |
| sp|O82178|PP186_ARATH | Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 | 795 | 1006 | 7.0E-07 |
| sp|Q9LZP3|PP293_ARATH | Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 | 817 | 1130 | 7.0E-07 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 818 | 1135 | 8.0E-07 |
| sp|Q9ZUU3|PP190_ARATH | Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 | 205 | 451 | 9.0E-07 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 714 | 898 | 9.0E-07 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 682 | 956 | 9.0E-07 |
| sp|Q9LFM6|PP375_ARATH | Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 | 849 | 998 | 9.0E-07 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 227 | 504 | 9.0E-07 |
| sp|Q9LUD6|PP230_ARATH | Pentatricopeptide repeat-containing protein At3g14580, mitochondrial OS=Arabidopsis thaliana GN=At3g14580 PE=2 SV=1 | 805 | 1002 | 9.0E-07 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 714 | 1130 | 1.0E-06 |
| sp|Q8GZ63|PP397_ARATH | Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 | 793 | 1136 | 1.0E-06 |
| sp|Q9SAA6|PPR34_ARATH | Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 | 779 | 1093 | 1.0E-06 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 880 | 1130 | 1.0E-06 |
| sp|Q9SAB4|PPR33_ARATH | Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=2 SV=1 | 834 | 1061 | 1.0E-06 |
| sp|Q9LS25|PP420_ARATH | Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 | 715 | 950 | 1.0E-06 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 710 | 912 | 2.0E-06 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 713 | 966 | 2.0E-06 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 817 | 1136 | 2.0E-06 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 710 | 1119 | 2.0E-06 |
| sp|P0C896|PP209_ARATH | Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 | 731 | 954 | 2.0E-06 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 796 | 1130 | 2.0E-06 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 833 | 1140 | 2.0E-06 |
| sp|P0C043|PP318_ARATH | Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 | 722 | 1004 | 2.0E-06 |
| sp|Q9LN69|PPR50_ARATH | Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2 | 831 | 1130 | 2.0E-06 |
| sp|Q9FLD8|PP408_ARATH | Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 | 820 | 1093 | 2.0E-06 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 833 | 1153 | 3.0E-06 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 673 | 1027 | 3.0E-06 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 801 | 1127 | 3.0E-06 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 848 | 1029 | 3.0E-06 |
| sp|Q9LS25|PP420_ARATH | Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 | 794 | 1038 | 3.0E-06 |
| sp|Q3ECH5|PP107_ARATH | Pentatricopeptide repeat-containing protein At1g66345, mitochondrial OS=Arabidopsis thaliana GN=At1g66345 PE=3 SV=1 | 859 | 1088 | 3.0E-06 |
| sp|Q9FMU2|PP380_ARATH | Pentatricopeptide repeat-containing protein At5g14080 OS=Arabidopsis thaliana GN=At5g14080 PE=2 SV=2 | 777 | 966 | 3.0E-06 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 710 | 966 | 4.0E-06 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 230 | 520 | 4.0E-06 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 232 | 431 | 5.0E-06 |
| sp|Q8LE47|PPR87_ARATH | Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2 | 802 | 992 | 5.0E-06 |
| sp|Q9LFQ4|PP383_ARATH | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 | 834 | 1088 | 6.0E-06 |
| sp|O82178|PP186_ARATH | Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 | 721 | 979 | 6.0E-06 |
| sp|Q9SZL5|PP356_ARATH | Pentatricopeptide repeat-containing protein At4g38150 OS=Arabidopsis thaliana GN=At4g38150 PE=2 SV=1 | 834 | 912 | 6.0E-06 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 839 | 1103 | 7.0E-06 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 734 | 1137 | 7.0E-06 |
| sp|Q9SZ20|PP339_ARATH | Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 | 831 | 1119 | 7.0E-06 |
| sp|Q9LUJ4|PP248_ARATH | Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 | 782 | 913 | 7.0E-06 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 783 | 1093 | 8.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 35 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|3640 MPTIYSSLYSNFIRQGSTFAKSITTHGYAQSVVAATHPHVLNSQNRPVFGRRHTNRLGRLSTLQLCSAFHSDRTG SAFAADSRHGHLHGGLDAYFEALQKKQADGETDIEWTQFEFPKRIEWKPSTSTVLADGQSVVPESSDAVSALSAD EAAALAQIDAALEREILVRGGELADPQPSAASPKPTSPGARRALTPGDAVAPAPVDEQSRSYADHLVHLSAEARY VEIPSVFEAMLANGVKPMASAYNALLMAAIHLPTKKIEVVSKALDVYADMVRRRVSPDSDTFDILVGLLASRSLE VSEMKASLEEKRRRFGGIEEPGKFMFTSHELEHAILCEDDRLDLAIKLFDASIDASTAAYSAETYHHLISACARA GRVSDMLRLFGHMESNKVIPYAAVFPAMITAFATRGDLVSAVECYDEYRSLAVADDGGRAVLRDRLDDQVYAAVI NAYVVCDKPAGAVKFFKRIVDEYGVRAVDINAALVTSGFVQGFISRGIYDEALKWAQSIEAEARSGALSRIAIAA ADDGDEPTAVTAHAGIPAMSGTLTPTIALLAMSIRGGDVASATKYWHVLANPEVRATAQLIEPTAMFAVALIGSG QVVEGLVQSEMMFQRIRASEPEVGSQLVGEIDEGASFIHRYMESRGISDPRIPVSPPSSSIPSQTMTGSPFLSTT TTTSVEDSYDPHAQSIDFKGSSLIADDLEGGHGRKGPRLTEAMNRFRNMRRAGRHPRYITYAKLISAAAREGKME LCLDILGTARTDVPLLPQYAAVRYGWSSILDAMVGACLGMGNRGRAEQYHQELLEIGSAPSANTFGLYITTLKES TKTFDEASEAVRIFQRAKSEGVEPSSFLYNALIGKLGKARRIDDCLFYFSEMRALGVKPTSVTYGTIVNALCRVS DEKFAEELFDEMEAMPNYKARPAPYNSMMQFFLTTKRDKSKVLTYYERMLTRNIAPTSHTYKLLIDTHATLDPVD MTAAEQVLGRIRASGQRAESVHYASLIHAKGCALHDVAGARKLFDSVVRESLAPVQACLFQALFEGMVANHMVAE TEPLLALMRERRVELTPYIANTLIHGWAAQKRIDKAKAIYDSVSRECREPSTYEAMTRAFLAVEDREQARGVAGE MVTRGYPSAVVNKVLELLGGGHEAAAEY* |
| Coding | >Ophun1|3640 ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG GCGGAGTATTAG |
| Transcript | >Ophun1|3640 ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG GCGGAGTATTAG |
| Gene | >Ophun1|3640 ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG GCGGAGTATTAG |