Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3640
Gene name
LocationContig_325:12343..15805
Strand-
Gene length (bp)3462
Transcript length (bp)3462
Coding sequence length (bp)3462
Protein length (aa) 1154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 7.2E-09 849 898
PF13812 PPR_3 Pentatricopeptide repeat domain 1.0E-03 361 407
PF13812 PPR_3 Pentatricopeptide repeat domain 1.1E-02 833 863
PF13812 PPR_3 Pentatricopeptide repeat domain 5.6E-03 874 913
PF01535 PPR PPR repeat 2.2E-04 364 392
PF01535 PPR PPR repeat 1.7E-03 853 882
PF01535 PPR PPR repeat 1.3E-03 887 913
PF12854 PPR_1 PPR repeat 1.5E-07 881 913
PF17177 PPR_long Pentacotripeptide-repeat region of PRORP 7.2E-07 821 966

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 730 1145 1.0E-71
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 637 1130 2.0E-21
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 716 1120 7.0E-21
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 713 1130 5.0E-20
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 708 1140 8.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 730 1145 1.0E-71
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 637 1130 2.0E-21
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 716 1120 7.0E-21
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 713 1130 5.0E-20
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 708 1140 8.0E-20
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 721 1124 1.0E-19
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 724 1126 7.0E-19
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 707 1136 1.0E-18
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 713 1136 3.0E-18
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 724 1130 3.0E-18
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 803 1130 7.0E-18
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 713 1144 1.0E-17
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 790 1097 1.0E-17
sp|Q9ZUU3|PP190_ARATH Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 707 1143 2.0E-17
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 216 1131 3.0E-17
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 710 1130 3.0E-17
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 780 1136 4.0E-17
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 716 1098 5.0E-17
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 718 1130 5.0E-17
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 706 1022 6.0E-17
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 713 1140 6.0E-17
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 713 1136 9.0E-17
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 776 1140 1.0E-16
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 708 1126 1.0E-16
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 689 1100 2.0E-16
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 717 1147 4.0E-16
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 726 1106 5.0E-16
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 764 1130 1.0E-15
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 735 1123 1.0E-15
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 721 1130 2.0E-15
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 713 1095 2.0E-15
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 714 1148 3.0E-15
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 730 1152 4.0E-15
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 834 1109 5.0E-15
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 713 1149 5.0E-15
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 717 1136 6.0E-15
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 716 1075 6.0E-15
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 707 1089 6.0E-15
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 708 1135 7.0E-15
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 713 1106 7.0E-15
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 652 1136 8.0E-15
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 713 1110 8.0E-15
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 779 1096 9.0E-15
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 713 1135 9.0E-15
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 846 1130 1.0E-14
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 710 1058 1.0E-14
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 336 1055 1.0E-14
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 715 1131 2.0E-14
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 715 1131 2.0E-14
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 715 1146 2.0E-14
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 716 1130 2.0E-14
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 713 966 2.0E-14
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 710 1033 3.0E-14
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 716 1136 3.0E-14
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 711 1119 3.0E-14
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 800 1089 3.0E-14
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 834 1149 5.0E-14
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 731 1135 6.0E-14
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 717 1146 6.0E-14
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 735 1129 7.0E-14
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 707 1095 9.0E-14
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 715 1099 1.0E-13
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 834 1140 1.0E-13
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 807 1132 1.0E-13
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 834 1130 1.0E-13
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 791 1130 1.0E-13
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 721 1130 1.0E-13
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 710 937 2.0E-13
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 706 1152 2.0E-13
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 398 967 2.0E-13
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 713 965 2.0E-13
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 820 1147 3.0E-13
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 685 1135 3.0E-13
sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 706 965 4.0E-13
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 761 1107 5.0E-13
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 713 994 5.0E-13
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 717 956 6.0E-13
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 803 976 6.0E-13
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 680 1043 7.0E-13
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 834 1140 7.0E-13
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 781 1130 8.0E-13
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 724 1140 1.0E-12
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 833 1090 1.0E-12
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 721 1090 1.0E-12
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 713 1111 1.0E-12
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 834 1130 2.0E-12
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 839 1140 2.0E-12
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 716 1130 2.0E-12
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 807 1145 2.0E-12
sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 707 1110 2.0E-12
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 713 966 2.0E-12
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 710 1130 3.0E-12
sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 710 1029 3.0E-12
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 705 1130 3.0E-12
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 715 1130 3.0E-12
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 829 1130 3.0E-12
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 739 1146 4.0E-12
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 817 1100 4.0E-12
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 710 965 4.0E-12
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 796 1110 5.0E-12
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 715 1149 6.0E-12
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 752 1140 6.0E-12
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 829 1090 7.0E-12
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 713 967 7.0E-12
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 795 1110 7.0E-12
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 803 1135 9.0E-12
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 716 966 1.0E-11
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 713 1106 1.0E-11
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 794 1130 1.0E-11
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 373 922 1.0E-11
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 831 1142 1.0E-11
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 661 1090 1.0E-11
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 714 965 1.0E-11
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 796 1106 2.0E-11
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 710 1095 2.0E-11
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 713 1086 2.0E-11
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 799 1090 2.0E-11
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 654 1060 2.0E-11
sp|Q9FFE3|PP388_ARATH Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 835 1095 2.0E-11
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 706 1119 2.0E-11
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 714 1023 2.0E-11
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 711 1131 3.0E-11
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 831 1136 3.0E-11
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 711 965 3.0E-11
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 709 1110 3.0E-11
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 724 1097 3.0E-11
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 713 1130 4.0E-11
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 710 1103 4.0E-11
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 781 1002 4.0E-11
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 728 966 6.0E-11
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 710 1099 6.0E-11
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 731 1029 7.0E-11
sp|A3KPF8|PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 619 1129 7.0E-11
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 727 1102 9.0E-11
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 723 912 9.0E-11
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 716 1144 1.0E-10
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 716 1060 1.0E-10
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 711 1130 1.0E-10
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 723 1037 1.0E-10
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 693 964 1.0E-10
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 791 1106 1.0E-10
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 693 1140 2.0E-10
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 839 1136 2.0E-10
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 731 966 2.0E-10
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 807 1130 2.0E-10
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 713 1029 2.0E-10
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 714 1050 3.0E-10
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 338 1023 3.0E-10
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 779 1130 3.0E-10
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 710 1136 3.0E-10
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 807 1101 3.0E-10
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 820 1143 4.0E-10
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 835 1130 4.0E-10
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 716 1122 4.0E-10
sp|Q9M8M3|PP136_ARATH Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 790 1004 4.0E-10
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 714 966 5.0E-10
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 713 1106 5.0E-10
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 776 1130 5.0E-10
sp|Q0WKZ3|PP105_ARATH Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 846 1091 5.0E-10
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 224 473 6.0E-10
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 710 966 6.0E-10
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 724 1130 6.0E-10
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 364 965 6.0E-10
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 789 1136 7.0E-10
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 773 1001 8.0E-10
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 706 1029 9.0E-10
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 849 1130 1.0E-09
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 789 1063 1.0E-09
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 696 1140 1.0E-09
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 832 1127 1.0E-09
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 827 1132 1.0E-09
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 716 1060 2.0E-09
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 713 930 2.0E-09
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 802 1119 2.0E-09
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 779 1090 2.0E-09
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 790 1058 2.0E-09
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 713 1139 2.0E-09
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 713 930 3.0E-09
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 833 1131 3.0E-09
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 695 1004 3.0E-09
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 691 1115 3.0E-09
sp|P0C896|PP209_ARATH Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 856 1126 3.0E-09
sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 792 1014 3.0E-09
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 710 1091 4.0E-09
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 731 1032 4.0E-09
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 714 1144 6.0E-09
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 790 1058 6.0E-09
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 721 1131 6.0E-09
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 838 1126 6.0E-09
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 795 1134 8.0E-09
sp|Q0WP85|PP150_ARATH Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 796 1047 8.0E-09
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 444 1086 9.0E-09
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 831 1130 1.0E-08
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 710 1002 1.0E-08
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 721 1076 1.0E-08
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 803 1086 1.0E-08
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 779 1144 1.0E-08
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 831 965 1.0E-08
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 854 1130 1.0E-08
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 710 912 2.0E-08
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 706 965 2.0E-08
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 728 1133 2.0E-08
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 707 1004 2.0E-08
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 710 1127 2.0E-08
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 827 1110 2.0E-08
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 708 1100 2.0E-08
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 707 1006 2.0E-08
sp|Q9FRS4|PPR22_ARATH Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 713 1002 2.0E-08
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 715 1006 2.0E-08
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 833 1132 2.0E-08
sp|Q56XR6|PP421_ARATH Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 722 913 2.0E-08
sp|Q9M8W9|PP211_ARATH Pentatricopeptide repeat-containing protein At3g04130, mitochondrial OS=Arabidopsis thaliana GN=At3g04130 PE=2 SV=2 807 914 2.0E-08
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 827 1133 3.0E-08
sp|Q9LFM6|PP375_ARATH Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 795 1106 3.0E-08
sp|Q9C9U0|PP118_ARATH Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 791 1058 3.0E-08
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 781 965 3.0E-08
sp|Q8GYM2|PP393_ARATH Pentatricopeptide repeat-containing protein At5g18950 OS=Arabidopsis thaliana GN=At5g18950 PE=2 SV=2 716 901 3.0E-08
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 835 1140 4.0E-08
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 815 1093 4.0E-08
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 709 1000 4.0E-08
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 838 1136 4.0E-08
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 706 1041 5.0E-08
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 724 1141 5.0E-08
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 847 1135 5.0E-08
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 230 493 6.0E-08
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 776 1136 6.0E-08
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 711 964 6.0E-08
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 790 1131 6.0E-08
sp|Q9LK58|PP225_ARATH Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1 781 1002 6.0E-08
sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 768 1002 6.0E-08
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 709 1149 7.0E-08
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 847 1135 7.0E-08
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 713 965 7.0E-08
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 731 1148 7.0E-08
sp|Q9FND8|PP409_ARATH Pentatricopeptide repeat-containing protein At5g40400 OS=Arabidopsis thaliana GN=At5g40400 PE=2 SV=1 832 1126 7.0E-08
sp|Q9SZ20|PP339_ARATH Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 835 1130 7.0E-08
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 707 990 7.0E-08
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 710 898 7.0E-08
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 818 1130 8.0E-08
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 710 1092 8.0E-08
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 710 972 8.0E-08
sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 785 965 8.0E-08
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 791 1096 9.0E-08
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 834 965 9.0E-08
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 710 1029 9.0E-08
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 713 912 1.0E-07
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 713 930 1.0E-07
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 703 1107 1.0E-07
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 707 1132 1.0E-07
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 706 915 1.0E-07
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 779 1111 1.0E-07
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 231 912 1.0E-07
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 838 1136 1.0E-07
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 648 1046 1.0E-07
sp|Q84J46|PP262_ARATH Pentatricopeptide repeat-containing protein At3g29290 OS=Arabidopsis thaliana GN=EMB2076 PE=2 SV=1 721 965 1.0E-07
sp|Q9SAA6|PPR34_ARATH Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 710 1130 1.0E-07
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 230 502 2.0E-07
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 781 1089 2.0E-07
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 835 1135 2.0E-07
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 707 918 3.0E-07
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 710 1034 3.0E-07
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 713 930 3.0E-07
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 731 1148 3.0E-07
sp|Q9SF38|PP222_ARATH Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 783 961 3.0E-07
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 810 1004 3.0E-07
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 230 556 4.0E-07
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 847 1140 4.0E-07
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 724 1096 5.0E-07
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 835 1130 5.0E-07
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 731 912 5.0E-07
sp|Q9FX35|PP117_ARATH Pentatricopeptide repeat-containing protein At1g73400, mitochondrial OS=Arabidopsis thaliana GN=At1g73400 PE=2 SV=2 726 975 5.0E-07
sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 817 1137 5.0E-07
sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 817 1137 5.0E-07
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 701 964 6.0E-07
sp|Q0WKZ3|PP105_ARATH Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 710 1060 6.0E-07
sp|Q9LIL5|PP233_ARATH Putative pentatricopeptide repeat-containing protein At3g15200 OS=Arabidopsis thaliana GN=At3g15200 PE=3 SV=1 785 1029 6.0E-07
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 724 1139 7.0E-07
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 807 1131 7.0E-07
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 706 1096 7.0E-07
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 795 1006 7.0E-07
sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 817 1130 7.0E-07
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 818 1135 8.0E-07
sp|Q9ZUU3|PP190_ARATH Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 205 451 9.0E-07
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 714 898 9.0E-07
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 682 956 9.0E-07
sp|Q9LFM6|PP375_ARATH Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 849 998 9.0E-07
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 227 504 9.0E-07
sp|Q9LUD6|PP230_ARATH Pentatricopeptide repeat-containing protein At3g14580, mitochondrial OS=Arabidopsis thaliana GN=At3g14580 PE=2 SV=1 805 1002 9.0E-07
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 714 1130 1.0E-06
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 793 1136 1.0E-06
sp|Q9SAA6|PPR34_ARATH Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 779 1093 1.0E-06
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 880 1130 1.0E-06
sp|Q9SAB4|PPR33_ARATH Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=2 SV=1 834 1061 1.0E-06
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 715 950 1.0E-06
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 710 912 2.0E-06
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 713 966 2.0E-06
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 817 1136 2.0E-06
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 710 1119 2.0E-06
sp|P0C896|PP209_ARATH Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 731 954 2.0E-06
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 796 1130 2.0E-06
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 833 1140 2.0E-06
sp|P0C043|PP318_ARATH Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 722 1004 2.0E-06
sp|Q9LN69|PPR50_ARATH Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2 831 1130 2.0E-06
sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 820 1093 2.0E-06
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 833 1153 3.0E-06
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 673 1027 3.0E-06
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 801 1127 3.0E-06
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 848 1029 3.0E-06
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 794 1038 3.0E-06
sp|Q3ECH5|PP107_ARATH Pentatricopeptide repeat-containing protein At1g66345, mitochondrial OS=Arabidopsis thaliana GN=At1g66345 PE=3 SV=1 859 1088 3.0E-06
sp|Q9FMU2|PP380_ARATH Pentatricopeptide repeat-containing protein At5g14080 OS=Arabidopsis thaliana GN=At5g14080 PE=2 SV=2 777 966 3.0E-06
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 710 966 4.0E-06
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 230 520 4.0E-06
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 232 431 5.0E-06
sp|Q8LE47|PPR87_ARATH Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2 802 992 5.0E-06
sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 834 1088 6.0E-06
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 721 979 6.0E-06
sp|Q9SZL5|PP356_ARATH Pentatricopeptide repeat-containing protein At4g38150 OS=Arabidopsis thaliana GN=At4g38150 PE=2 SV=1 834 912 6.0E-06
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 839 1103 7.0E-06
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 734 1137 7.0E-06
sp|Q9SZ20|PP339_ARATH Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 831 1119 7.0E-06
sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 782 913 7.0E-06
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 783 1093 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3640
MPTIYSSLYSNFIRQGSTFAKSITTHGYAQSVVAATHPHVLNSQNRPVFGRRHTNRLGRLSTLQLCSAFHSDRTG
SAFAADSRHGHLHGGLDAYFEALQKKQADGETDIEWTQFEFPKRIEWKPSTSTVLADGQSVVPESSDAVSALSAD
EAAALAQIDAALEREILVRGGELADPQPSAASPKPTSPGARRALTPGDAVAPAPVDEQSRSYADHLVHLSAEARY
VEIPSVFEAMLANGVKPMASAYNALLMAAIHLPTKKIEVVSKALDVYADMVRRRVSPDSDTFDILVGLLASRSLE
VSEMKASLEEKRRRFGGIEEPGKFMFTSHELEHAILCEDDRLDLAIKLFDASIDASTAAYSAETYHHLISACARA
GRVSDMLRLFGHMESNKVIPYAAVFPAMITAFATRGDLVSAVECYDEYRSLAVADDGGRAVLRDRLDDQVYAAVI
NAYVVCDKPAGAVKFFKRIVDEYGVRAVDINAALVTSGFVQGFISRGIYDEALKWAQSIEAEARSGALSRIAIAA
ADDGDEPTAVTAHAGIPAMSGTLTPTIALLAMSIRGGDVASATKYWHVLANPEVRATAQLIEPTAMFAVALIGSG
QVVEGLVQSEMMFQRIRASEPEVGSQLVGEIDEGASFIHRYMESRGISDPRIPVSPPSSSIPSQTMTGSPFLSTT
TTTSVEDSYDPHAQSIDFKGSSLIADDLEGGHGRKGPRLTEAMNRFRNMRRAGRHPRYITYAKLISAAAREGKME
LCLDILGTARTDVPLLPQYAAVRYGWSSILDAMVGACLGMGNRGRAEQYHQELLEIGSAPSANTFGLYITTLKES
TKTFDEASEAVRIFQRAKSEGVEPSSFLYNALIGKLGKARRIDDCLFYFSEMRALGVKPTSVTYGTIVNALCRVS
DEKFAEELFDEMEAMPNYKARPAPYNSMMQFFLTTKRDKSKVLTYYERMLTRNIAPTSHTYKLLIDTHATLDPVD
MTAAEQVLGRIRASGQRAESVHYASLIHAKGCALHDVAGARKLFDSVVRESLAPVQACLFQALFEGMVANHMVAE
TEPLLALMRERRVELTPYIANTLIHGWAAQKRIDKAKAIYDSVSRECREPSTYEAMTRAFLAVEDREQARGVAGE
MVTRGYPSAVVNKVLELLGGGHEAAAEY*
Coding >Ophun1|3640
ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT
CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC
CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC
TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG
AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC
ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC
GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC
CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG
GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT
GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG
CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG
GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA
GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG
TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC
GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC
GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC
CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC
CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC
AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT
CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC
GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT
GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC
ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC
AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG
CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT
CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA
CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG
ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC
GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT
CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG
CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC
TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT
CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG
ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC
TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC
GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC
GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC
AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG
ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC
ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG
CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG
TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG
ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC
GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG
AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG
ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG
GCGGAGTATTAG
Transcript >Ophun1|3640
ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT
CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC
CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC
TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG
AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC
ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC
GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC
CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG
GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT
GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG
CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG
GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA
GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG
TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC
GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC
GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC
CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC
CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC
AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT
CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC
GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT
GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC
ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC
AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG
CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT
CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA
CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG
ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC
GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT
CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG
CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC
TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT
CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG
ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC
TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC
GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC
GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC
AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG
ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC
ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG
CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG
TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG
ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC
GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG
AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG
ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG
GCGGAGTATTAG
Gene >Ophun1|3640
ATGCCAACCATCTACTCGTCGCTCTACTCGAATTTCATCCGTCAAGGATCAACATTCGCAAAGTCCATCACTACT
CACGGCTACGCGCAGTCCGTCGTAGCCGCCACACACCCTCATGTCCTAAACTCGCAGAATCGCCCCGTCTTTGGC
CGCCGCCACACCAATCGACTTGGCCGTCTGTCGACTCTTCAGCTCTGCTCGGCTTTTCATTCCGACCGGACAGGC
TCTGCCTTTGCCGCCGATAGCCGTCATGGTCACCTACACGGAGGCTTAGATGCCTATTTCGAGGCTCTTCAGAAG
AAGCAGGCCGATGGCGAGACCGATATCGAGTGGACACAGTTCGAGTTTCCGAAGCGTATCGAGTGGAAGCCCAGC
ACTTCTACCGTTCTCGCCGATGGGCAGTCTGTCGTTCCAGAGTCTTCCGATGCTGTCTCTGCCCTTTCGGCCGAC
GAGGCCGCTGCGCTCGCGCAAATCGATGCCGCTCTCGAGAGGGAGATCTTGGTACGAGGAGGAGAGCTTGCCGAC
CCTCAGCCATCAGCAGCTTCACCCAAGCCGACAAGTCCGGGTGCTCGCCGGGCCTTGACTCCAGGGGACGCTGTG
GCGCCGGCCCCCGTCGACGAGCAGTCTCGGTCGTACGCAGATCACCTTGTCCACCTGTCGGCCGAGGCTCGCTAT
GTGGAGATACCGTCCGTCTTCGAGGCCATGCTGGCAAACGGAGTCAAGCCCATGGCCAGCGCCTACAATGCGCTG
CTCATGGCCGCCATCCATCTCCCGACCAAGAAGATCGAGGTCGTCTCCAAGGCTCTGGACGTCTATGCCGACATG
GTGCGCAGGCGAGTCTCCCCCGACAGCGACACCTTTGACATACTCGTCGGCCTCTTGGCCTCCCGGTCATTGGAA
GTGTCGGAGATGAAGGCCTCGCTCGAGGAGAAGCGCAGACGCTTTGGTGGAATCGAGGAACCGGGAAAATTCATG
TTCACCTCCCATGAGCTCGAGCATGCCATTCTCTGTGAGGACGACAGGCTTGATCTCGCCATCAAGCTGTTTGAC
GCTTCGATCGACGCCAGCACGGCTGCCTACTCTGCAGAGACATATCATCACCTGATATCGGCTTGCGCCCGCGCC
GGCCGCGTCTCTGACATGCTCAGGCTGTTTGGGCACATGGAGTCGAACAAGGTGATCCCGTACGCGGCAGTCTTC
CCGGCCATGATTACCGCCTTCGCCACCCGCGGCGATCTCGTCAGCGCTGTCGAATGCTACGACGAGTATCGGAGC
CTTGCCGTGGCCGACGACGGTGGTCGGGCCGTCCTTCGCGATCGACTCGATGATCAGGTCTATGCCGCGGTCATC
AATGCCTACGTCGTCTGCGACAAGCCAGCGGGTGCCGTCAAGTTCTTCAAGAGGATAGTCGACGAGTACGGCGTT
CGGGCTGTGGACATCAACGCCGCCTTGGTCACTTCGGGCTTCGTTCAGGGCTTCATCTCCCGAGGCATCTATGAC
GAGGCATTGAAGTGGGCTCAGTCCATCGAGGCCGAAGCCCGCTCGGGGGCCCTGAGTCGCATCGCCATTGCCGCT
GCCGACGATGGCGACGAACCGACGGCTGTCACGGCTCACGCCGGCATCCCGGCCATGTCCGGCACGTTGACGCCC
ACGATAGCGCTGCTTGCCATGAGCATCCGTGGGGGAGACGTCGCTTCAGCTACCAAATACTGGCATGTCCTGGCC
AATCCCGAAGTACGCGCGACGGCGCAGCTCATCGAGCCGACAGCCATGTTTGCCGTTGCTCTGATCGGTTCCGGG
CAGGTGGTCGAGGGCCTCGTTCAGTCAGAGATGATGTTTCAGCGAATCCGGGCGTCGGAGCCGGAGGTGGGATCT
CAACTCGTGGGCGAGATTGACGAAGGCGCCAGCTTCATCCATCGCTACATGGAGTCTCGGGGCATCAGCGATCCA
CGGATACCGGTGTCTCCCCCGTCGTCGAGCATCCCATCGCAGACGATGACGGGCTCGCCTTTCCTGTCGACTACG
ACGACGACGAGTGTCGAAGATAGCTACGATCCCCACGCCCAGAGCATCGACTTCAAGGGCTCGTCGCTGATTGCC
GACGATCTCGAGGGTGGTCACGGCCGGAAGGGCCCTCGTCTGACCGAGGCCATGAACCGCTTCCGCAACATGCGT
CGCGCTGGCCGGCATCCTCGCTACATCACCTACGCCAAACTCATCTCGGCCGCGGCCCGTGAAGGTAAGATGGAG
CTGTGTCTCGACATCCTCGGCACGGCGCGCACCGACGTGCCGTTGCTGCCCCAGTACGCTGCCGTGCGATACGGC
TGGTCCTCCATCCTGGACGCCATGGTCGGAGCTTGTCTCGGCATGGGCAACCGTGGACGGGCCGAGCAGTACCAT
CAGGAGCTTCTCGAGATCGGCTCGGCGCCGTCAGCCAACACGTTTGGTCTCTACATCACGACGCTCAAGGAATCG
ACCAAGACGTTTGACGAGGCGTCCGAGGCGGTGCGCATCTTTCAGCGCGCCAAGAGCGAGGGCGTGGAACCCAGC
TCGTTCCTTTACAACGCCCTCATCGGCAAGCTGGGCAAGGCTCGTCGCATCGACGACTGTCTCTTTTACTTTTCC
GAGATGAGGGCCCTGGGCGTCAAGCCAACGTCGGTGACGTACGGCACGATTGTCAATGCCCTGTGCCGGGTCAGC
GACGAGAAGTTTGCCGAGGAACTCTTTGATGAGATGGAGGCCATGCCCAACTACAAGGCCAGGCCGGCGCCCTAC
AACAGCATGATGCAGTTCTTCCTGACGACGAAGCGCGACAAGAGCAAGGTGCTGACGTACTACGAGCGCATGCTG
ACGCGCAACATTGCGCCGACATCTCACACGTACAAGCTGCTGATCGACACGCACGCGACGCTCGATCCGGTGGAC
ATGACGGCTGCCGAACAGGTTCTCGGGAGGATTCGAGCGTCGGGACAGCGGGCCGAGTCGGTGCATTACGCGTCG
CTCATCCACGCCAAGGGATGCGCCCTCCACGACGTGGCCGGGGCGCGGAAGCTGTTTGACAGCGTGGTGCGAGAG
TCGCTGGCGCCGGTACAGGCGTGCTTGTTCCAGGCGCTCTTTGAGGGCATGGTGGCCAACCACATGGTGGCGGAG
ACGGAGCCCCTACTGGCTCTGATGCGGGAGAGGAGGGTCGAGCTGACTCCTTACATTGCCAACACGCTGATCCAC
GGCTGGGCGGCGCAGAAGAGGATCGACAAGGCCAAGGCCATCTACGACAGCGTCAGCCGAGAGTGCCGGGAGCCG
AGCACGTACGAGGCCATGACGCGGGCTTTTCTCGCCGTCGAAGACAGGGAGCAGGCCCGGGGGGTGGCGGGCGAG
ATGGTGACGCGCGGATACCCCAGCGCCGTGGTCAACAAGGTGCTGGAGCTGCTGGGCGGTGGGCACGAAGCAGCG
GCGGAGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail