Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3638
Gene name
LocationContig_325:9453..10166
Strand+
Gene length (bp)713
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6887
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03537
Ophiocordyceps camponoti-rufipedis Ophun1|3638 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5008
Ophiocordyceps kimflemingae Ophio5|8387

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3638
MVAKTTTSCSGEMVVKTSNRWQKRTQGQRRSCCGLRRELSCQSISNLTVDFHLGNDMGAGTWDTIAVEVGALRGK
SGITKLAREPEGGFLSNHTFDLQSIFGSRTVPLSDINPVRLVDISGKGFYFRKDQWEFGGITLTATCADSSQRIE
MTKYRSVNKWLQNNSEGLFNPDQVWEGEIAPSDWSLKKESNTEIYHEKHPNRDTPKKESKKWPKDENK*
Coding >Ophun1|3638
ATGGTCGCCAAGACTACCACCAGCTGCTCTGGTGAAATGGTCGTCAAGACCAGCAACAGATGGCAAAAACGGACA
CAAGGCCAGAGAAGGAGTTGCTGCGGATTGAGACGAGAACTGAGTTGCCAGTCCATCTCGAACCTCACCGTCGAC
TTCCACCTCGGCAACGACATGGGCGCCGGCACCTGGGACACCATCGCCGTAGAGGTCGGCGCCCTCCGCGGCAAG
TCCGGCATCACGAAGCTCGCCAGGGAGCCAGAGGGGGGCTTTCTCTCGAACCACACCTTCGATCTTCAGTCCATC
TTTGGGTCTCGGACCGTGCCGCTGAGCGATATCAACCCTGTGAGGCTTGTGGATATATCCGGCAAGGGCTTCTAC
TTCAGAAAAGATCAGTGGGAGTTCGGAGGCATCACCCTCACCGCGACCTGCGCCGACTCCTCTCAAAGGATAGAG
ATGACAAAGTACCGCTCCGTTAACAAGTGGCTGCAGAACAACAGCGAGGGCCTCTTTAACCCCGATCAAGTCTGG
GAAGGTGAAATCGCCCCGAGTGACTGGAGCCTAAAGAAAGAGTCAAACACAGAGATTTACCATGAGAAGCACCCA
AATCGTGATACTCCGAAGAAAGAGTCAAAGAAATGGCCCAAGGACGAGAATAAATAG
Transcript >Ophun1|3638
ATGGTCGCCAAGACTACCACCAGCTGCTCTGGTGAAATGGTCGTCAAGACCAGCAACAGATGGCAAAAACGGACA
CAAGGCCAGAGAAGGAGTTGCTGCGGATTGAGACGAGAACTGAGTTGCCAGTCCATCTCGAACCTCACCGTCGAC
TTCCACCTCGGCAACGACATGGGCGCCGGCACCTGGGACACCATCGCCGTAGAGGTCGGCGCCCTCCGCGGCAAG
TCCGGCATCACGAAGCTCGCCAGGGAGCCAGAGGGGGGCTTTCTCTCGAACCACACCTTCGATCTTCAGTCCATC
TTTGGGTCTCGGACCGTGCCGCTGAGCGATATCAACCCTGTGAGGCTTGTGGATATATCCGGCAAGGGCTTCTAC
TTCAGAAAAGATCAGTGGGAGTTCGGAGGCATCACCCTCACCGCGACCTGCGCCGACTCCTCTCAAAGGATAGAG
ATGACAAAGTACCGCTCCGTTAACAAGTGGCTGCAGAACAACAGCGAGGGCCTCTTTAACCCCGATCAAGTCTGG
GAAGGTGAAATCGCCCCGAGTGACTGGAGCCTAAAGAAAGAGTCAAACACAGAGATTTACCATGAGAAGCACCCA
AATCGTGATACTCCGAAGAAAGAGTCAAAGAAATGGCCCAAGGACGAGAATAAATAG
Gene >Ophun1|3638
ATGGTCGCCAAGACTACCACCAGCTGCTCTGGTGAAATGGTCGTCAAGACCAGCAACAGATGGCAAAAACGGTAT
GAGGATCCGCAACATACAACTTCAGGTCGTGCATCAAAGGCTAACGGTACAGGACACAAGGCCAGAGAAGGAGTT
GCTGCGGATTGAGACGAGAACTGAGTTGCCAGTCCATCTCGAACCTCACCGTCGACTTCCACCTCGGCAACGACA
TGGGCGCCGGCACCTGGGACACCATCGCCGTAGAGGTCGGCGCCCTCCGCGGCAAGTCCGGCATCACGAAGCTCG
CCAGGGAGCCAGAGGGGGGCTTTCTCTCGAACCACACCTTCGATCTTCAGTCCATCTTTGGGTCTCGGACCGTGC
CGCTGAGCGATATCAACCCTGTGAGGCTTGTGGATATATCCGGCAAGGGCTTCTACTTCAGAAAAGATCAGTGGG
AGTTCGGAGGCATCACCCTCACCGCGACCTGCGCCGACTCCTCTCAAAGGATAGAGATGACAAAGTACCGCTCCG
TTAACAAGTGGCTGCAGAACAACAGCGAGGGCCTCTTTAACCCCGATCAAGTCTGGGAAGGTGAAATCGCCCCGA
GTGACTGGAGCCTAAAGAAAGAGTCAAACACAGAGATTTACCATGAGAAGCACCCAAATCGTGATACTCCGAAGA
AAGAGTCAAAGAAATGGCCCAAGGACGAGAATAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail