Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3630
Gene name
LocationContig_323:15485..16250
Strand-
Gene length (bp)765
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 4.2E-05 141 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P3B2|RCF2_SCHPO Respiratory supercomplex factor 2 homolog C1565.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rcf2 PE=3 SV=1 1 222 9.0E-24
sp|P53721|RCF2_YEAST Respiratory supercomplex factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF2 PE=1 SV=1 1 184 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 116 135 19
3 145 167 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3630
MKVLSKEEEAAHYSVVLNGGIVGGIAGFGLGLGGVIFAFRRYPAFRGLTLPFRTFLVTSSTTFGAIVNADRQSTR
FQRAQHVDSDYRDASQRAAEMIRDNESTYQRFMAWGREHRYSIVFASWVASMGVALTIVGRAPISTPQKLVQARI
YAQALTLAVLVVSAVFEMSDAKDGSGRWETVLVVDPNDPKHEHLIEKKVHREDYEGQDMWKDMVEAEEQRLKDKE
RKATKS*
Coding >Ophun1|3630
ATGAAGGTGCTCAGCAAGGAAGAGGAGGCGGCGCACTACTCCGTCGTCCTCAACGGTGGCATCGTCGGCGGCATC
GCTGGCTTCGGGCTCGGGCTCGGTGGCGTCATCTTCGCCTTTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTG
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCGCAGCATGTCGACAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGATAAC
GAGTCGACGTATCAGCGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATCGTCTTTGCTTCCTGGGTTGCT
AGCATGGGCGTCGCTCTGACCATAGTCGGCCGCGCCCCGATATCCACGCCTCAGAAGCTCGTCCAGGCTCGTATC
TACGCTCAGGCGCTGACGCTCGCCGTTCTTGTCGTCTCCGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGACCCCAACGACCCGAAGCACGAGCACCTCATCGAGAAGAAGGTGCAC
AGGGAGGATTACGAGGGCCAGGACATGTGGAAGGACATGGTCGAGGCCGAGGAACAACGGCTCAAGGACAAAGAG
CGCAAAGCAACCAAGTCCTAG
Transcript >Ophun1|3630
ATGAAGGTGCTCAGCAAGGAAGAGGAGGCGGCGCACTACTCCGTCGTCCTCAACGGTGGCATCGTCGGCGGCATC
GCTGGCTTCGGGCTCGGGCTCGGTGGCGTCATCTTCGCCTTTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTG
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCGCAGCATGTCGACAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGATAAC
GAGTCGACGTATCAGCGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATCGTCTTTGCTTCCTGGGTTGCT
AGCATGGGCGTCGCTCTGACCATAGTCGGCCGCGCCCCGATATCCACGCCTCAGAAGCTCGTCCAGGCTCGTATC
TACGCTCAGGCGCTGACGCTCGCCGTTCTTGTCGTCTCCGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGACCCCAACGACCCGAAGCACGAGCACCTCATCGAGAAGAAGGTGCAC
AGGGAGGATTACGAGGGCCAGGACATGTGGAAGGACATGGTCGAGGCCGAGGAACAACGGCTCAAGGACAAAGAG
CGCAAAGCAACCAAGTCCTAG
Gene >Ophun1|3630
ATGAAGGTGCTCAGCAAGGAAGAGGAGGCGGCGCACTACTCCGTCGTCCTCAACGGTGGCATCGTCGGCGGCATC
GCTGGCTTCGGGCTCGGGCTCGGTGGCGTCATCTTCGCCTTTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTG
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCGCAGCATGTCGACAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGATAAC
GAGTCGACGTATCAGCGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATCGTCTTTGCTTCCTGGGTTGCT
AGCATGGGCGTCGCTCTGACCATAGTCGGCCGCGCCCCGATATCCACGCCTCAGAAGCTCGTCCAGGCTCGTATC
TACGCTCAGGCGCTGACGCTCGCCGTTCTTGTCGTCTCCGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGACCCCAACGACCCGAAGCACGAGCACCTCATCGAGAAGAAGGTGCAC
AGGGAGGATTACGAGGGCCAGGACATGTGGAAGGGTACGGCTGCCTGCATTTCGTTACCCAGTCGTCTTCTTCTC
TGAGCCGCTCCGATGCTGACTTTTCCAGACATGGTCGAGGCCGAGGAACAACGGCTCAAGGACAAAGAGCGCAAA
GCAACCAAGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail