Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3629
Gene name
LocationContig_323:12409..14743
Strand-
Gene length (bp)2334
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 1.9E-28 325 535
PF01207 Dus Dihydrouridine synthase (Dus) 7.5E-08 571 617

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG01|DUS3_NEUCR tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dus-3 PE=3 SV=1 1 732 0.0E+00
sp|A7EKL8|DUS3_SCLS1 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dus3 PE=3 SV=1 10 732 0.0E+00
sp|Q2HDP2|DUS3_CHAGB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DUS3 PE=3 SV=2 2 731 0.0E+00
sp|A6RMI1|DUS3_BOTFB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Botryotinia fuckeliana (strain B05.10) GN=dus3 PE=3 SV=1 10 732 0.0E+00
sp|A4RLF4|DUS3_MAGO7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DUS3 PE=3 SV=1 1 732 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG01|DUS3_NEUCR tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dus-3 PE=3 SV=1 1 732 0.0E+00
sp|A7EKL8|DUS3_SCLS1 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dus3 PE=3 SV=1 10 732 0.0E+00
sp|Q2HDP2|DUS3_CHAGB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DUS3 PE=3 SV=2 2 731 0.0E+00
sp|A6RMI1|DUS3_BOTFB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Botryotinia fuckeliana (strain B05.10) GN=dus3 PE=3 SV=1 10 732 0.0E+00
sp|A4RLF4|DUS3_MAGO7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DUS3 PE=3 SV=1 1 732 0.0E+00
sp|Q0CZL3|DUS3_ASPTN tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dus3 PE=3 SV=1 57 732 0.0E+00
sp|A6QYC6|DUS3_AJECN tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DUS3 PE=3 SV=1 8 732 0.0E+00
sp|A1CNY3|DUS3_ASPCL tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dus3 PE=3 SV=1 50 732 0.0E+00
sp|Q4WRX4|DUS3_ASPFU tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dus3 PE=3 SV=1 57 732 0.0E+00
sp|A1D1U0|DUS3_NEOFI tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dus3 PE=3 SV=1 57 732 0.0E+00
sp|Q2UL89|DUS3_ASPOR tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dus3 PE=3 SV=1 20 732 0.0E+00
sp|A2QAU6|DUS3_ASPNC tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dus3 PE=3 SV=1 1 732 0.0E+00
sp|Q1E2F4|DUS3_COCIM tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coccidioides immitis (strain RS) GN=DUS3 PE=3 SV=1 10 732 0.0E+00
sp|Q5BF62|DUS3_EMENI tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dus3 PE=3 SV=1 44 732 0.0E+00
sp|Q0U9D6|DUS3_PHANO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DUS3 PE=3 SV=2 115 732 0.0E+00
sp|Q6C4K3|DUS3_YARLI tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DUS3 PE=3 SV=1 19 731 4.0E-167
sp|Q5ALL3|DUS3_CANAL tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUS3 PE=3 SV=1 60 729 1.0E-166
sp|A5DBS1|DUS3_PICGU tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DUS3 PE=3 SV=2 60 730 7.0E-164
sp|Q6BS64|DUS3_DEBHA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DUS3 PE=3 SV=1 33 729 4.0E-162
sp|A5DTS1|DUS3_LODEL tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DUS3 PE=3 SV=1 54 729 3.0E-158
sp|A3LUK5|DUS3_PICST tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DUS3 PE=3 SV=1 113 729 3.0E-156
sp|Q6FJ14|DUS3_CANGA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DUS3 PE=3 SV=1 56 729 2.0E-143
sp|Q9UTH9|DUS3_SCHPO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus3 PE=3 SV=1 103 732 6.0E-139
sp|A8NZY7|DUS3_COPC7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=DUS3 PE=3 SV=1 60 731 8.0E-136
sp|Q757E3|DUS3_ASHGO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DUS3 PE=3 SV=1 57 728 3.0E-131
sp|Q6CWM0|DUS3_KLULA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DUS3 PE=3 SV=1 39 728 4.0E-130
sp|A7TQ73|DUS3_VANPO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DUS3 PE=3 SV=1 60 728 3.0E-129
sp|P0CN29|DUS3_CRYNB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DUS3 PE=3 SV=1 40 731 1.0E-128
sp|P0CN28|DUS3_CRYNJ tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DUS3 PE=3 SV=1 40 731 1.0E-128
sp|Q28BT8|DUS3L_XENTR tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus tropicalis GN=dus3l PE=2 SV=2 83 729 6.0E-124
sp|Q7ZWS1|DUS3L_XENLA tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus laevis GN=dus3l PE=2 SV=1 83 729 1.0E-120
sp|Q06053|DUS3_YEAST tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS3 PE=1 SV=2 60 728 3.0E-120
sp|A7A1S5|DUS3_YEAS7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain YJM789) GN=DUS3 PE=3 SV=1 60 728 3.0E-120
sp|A8PTG4|DUS3_MALGO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=DUS3 PE=3 SV=1 174 732 3.0E-116
sp|Q96G46|DUS3L_HUMAN tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 85 729 2.0E-115
sp|Q91XI1|DUS3L_MOUSE tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus3l PE=1 SV=1 102 729 7.0E-114
sp|Q3KRC5|DUS3L_RAT tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus3l PE=2 SV=1 60 729 1.0E-113
sp|Q4P1U2|DUS3_USTMA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DUS3 PE=3 SV=1 308 731 3.0E-107
sp|Q54CU9|DUS3L_DICDI tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Dictyostelium discoideum GN=dus3l PE=3 SV=1 307 732 3.0E-105
sp|Q9T0J6|DUS3L_ARATH tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Arabidopsis thaliana GN=At4g38890 PE=1 SV=2 308 729 3.0E-98
sp|Q7XT07|DUS3L_ORYSJ tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Oryza sativa subsp. japonica GN=Os04g0117600 PE=2 SV=2 325 729 7.0E-95
sp|Q7VNP2|DUSB_HAEDU tRNA-dihydrouridine synthase B OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusB PE=3 SV=1 325 621 2.0E-19
sp|P45672|DUS_AZOBR Probable tRNA-dihydrouridine synthase OS=Azospirillum brasilense GN=dus PE=3 SV=1 325 618 7.0E-18
sp|Q8PCH1|DUSB_XANCP tRNA-dihydrouridine synthase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dusB PE=3 SV=1 316 612 8.0E-18
sp|Q9HUW1|DUSB_PSEAE tRNA-dihydrouridine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusB PE=3 SV=1 317 659 1.0E-17
sp|Q8PP72|DUSB_XANAC tRNA-dihydrouridine synthase B OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dusB PE=3 SV=1 325 612 2.0E-17
sp|Q1RH84|DUS_RICBR Probable tRNA-dihydrouridine synthase OS=Rickettsia bellii (strain RML369-C) GN=dus PE=3 SV=1 324 613 2.0E-17
sp|P44965|DUSB_HAEIN tRNA-dihydrouridine synthase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusB PE=3 SV=1 325 613 5.0E-17
sp|Q4UNJ4|DUS_RICFE Probable tRNA-dihydrouridine synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dus PE=3 SV=1 325 659 3.0E-16
sp|Q92JQ6|DUS_RICCN Probable tRNA-dihydrouridine synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dus PE=3 SV=2 325 659 4.0E-16
sp|P0A2R6|DUSB_SALTY tRNA-dihydrouridine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusB PE=3 SV=1 326 619 4.0E-16
sp|P0A2R7|DUSB_SALTI tRNA-dihydrouridine synthase B OS=Salmonella typhi GN=dusB PE=3 SV=1 326 619 4.0E-16
sp|Q9CLW3|DUSB_PASMU tRNA-dihydrouridine synthase B OS=Pasteurella multocida (strain Pm70) GN=dusB PE=3 SV=2 325 613 5.0E-16
sp|Q88DK5|DUSB_PSEPK tRNA-dihydrouridine synthase B OS=Pseudomonas putida (strain KT2440) GN=dusB PE=3 SV=1 325 659 1.0E-15
sp|Q87KU1|DUSB_VIBPA tRNA-dihydrouridine synthase B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusB PE=3 SV=2 325 629 1.0E-15
sp|O52533|DUSB_PROVU tRNA-dihydrouridine synthase B OS=Proteus vulgaris GN=dusB PE=3 SV=2 326 619 3.0E-15
sp|O67533|DUS_AQUAE Probable tRNA-dihydrouridine synthase OS=Aquifex aeolicus (strain VF5) GN=dus PE=3 SV=1 324 629 3.0E-15
sp|P41504|DUS_RHILP Probable tRNA-dihydrouridine synthase OS=Rhizobium leguminosarum bv. phaseoli GN=dus PE=3 SV=1 324 607 3.0E-15
sp|O25427|DUS_HELPY Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dus PE=3 SV=1 325 612 9.0E-15
sp|Q55724|DUS1_SYNY3 Probable tRNA-dihydrouridine synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dus1 PE=3 SV=1 326 613 2.0E-14
sp|O52536|DUSB_KLEPN tRNA-dihydrouridine synthase B OS=Klebsiella pneumoniae GN=dusB PE=3 SV=1 326 619 2.0E-14
sp|Q9ZED2|DUS_RICPR Probable tRNA-dihydrouridine synthase OS=Rickettsia prowazekii (strain Madrid E) GN=dus PE=3 SV=2 325 659 2.0E-14
sp|P0ABT5|DUSB_ECOLI tRNA-dihydrouridine synthase B OS=Escherichia coli (strain K12) GN=dusB PE=3 SV=1 326 619 2.0E-14
sp|P0ABT6|DUSB_ECOL6 tRNA-dihydrouridine synthase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusB PE=3 SV=1 326 619 2.0E-14
sp|P0ABT7|DUSB_ECO57 tRNA-dihydrouridine synthase B OS=Escherichia coli O157:H7 GN=dusB PE=3 SV=1 326 619 2.0E-14
sp|Q83PZ5|DUSB_SHIFL tRNA-dihydrouridine synthase B OS=Shigella flexneri GN=dusB PE=3 SV=1 326 619 2.0E-14
sp|Q68XZ3|DUS_RICTY Probable tRNA-dihydrouridine synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dus PE=3 SV=1 324 659 3.0E-14
sp|Q9ZLB6|DUS_HELPJ Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dus PE=3 SV=1 325 612 5.0E-14
sp|Q8ZAX7|DUSB_YERPE tRNA-dihydrouridine synthase B OS=Yersinia pestis GN=dusB PE=3 SV=1 326 619 2.0E-13
sp|Q87VS1|DUSB_PSESM tRNA-dihydrouridine synthase B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dusB PE=3 SV=1 318 659 4.0E-13
sp|P37567|DUS1_BACSU Probable tRNA-dihydrouridine synthase 1 OS=Bacillus subtilis (strain 168) GN=dus1 PE=3 SV=1 324 619 8.0E-13
sp|O52539|DUSB_PECCA tRNA-dihydrouridine synthase B OS=Pectobacterium carotovorum GN=dusB PE=3 SV=2 326 619 5.0E-12
sp|Q9HGN6|DUS1_SCHPO tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 324 609 1.0E-11
sp|Q50049|DUS_MYCLE Probable tRNA-dihydrouridine synthase OS=Mycobacterium leprae (strain TN) GN=dus PE=3 SV=1 325 613 2.0E-11
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 325 602 2.0E-11
sp|Q8CWL2|DUSB_VIBVU tRNA-dihydrouridine synthase B OS=Vibrio vulnificus (strain CMCP6) GN=dusB PE=3 SV=2 324 623 4.0E-11
sp|P9WNS7|DUS_MYCTU Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dus PE=1 SV=1 429 613 4.0E-11
sp|P9WNS6|DUS_MYCTO Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dus PE=3 SV=1 429 613 4.0E-11
sp|Q8EFG7|DUSC_SHEON tRNA-dihydrouridine(16) synthase OS=Shewanella oneidensis (strain MR-1) GN=dusC PE=3 SV=1 429 615 5.0E-11
sp|O83945|DUS_TREPA Probable tRNA-dihydrouridine synthase OS=Treponema pallidum (strain Nichols) GN=dus PE=3 SV=1 324 626 5.0E-11
sp|Q9JZL5|DUSC_NEIMB tRNA-dihydrouridine(16) synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dusC PE=3 SV=1 415 695 5.0E-11
sp|O68273|DUSC_CUPNH tRNA-dihydrouridine(16) synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dusC PE=3 SV=2 429 612 1.0E-10
sp|O52532|DUSB_SERMA tRNA-dihydrouridine synthase B OS=Serratia marcescens GN=dusB PE=3 SV=2 326 619 1.0E-10
sp|Q9AMN9|DUSC_PSEAC tRNA-dihydrouridine(16) synthase OS=Pseudomonas alcaligenes GN=dusC PE=3 SV=1 428 666 2.0E-10
sp|Q8EJR8|DUSB_SHEON tRNA-dihydrouridine synthase B OS=Shewanella oneidensis (strain MR-1) GN=dusB PE=3 SV=1 324 658 2.0E-10
sp|Q8XYX1|DUSC_RALSO tRNA-dihydrouridine(16) synthase OS=Ralstonia solanacearum (strain GMI1000) GN=dusC PE=3 SV=1 429 622 3.0E-10
sp|Q9JUP6|DUSC_NEIMA tRNA-dihydrouridine(16) synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dusC PE=3 SV=1 415 663 4.0E-10
sp|Q9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS2 PE=1 SV=1 325 609 5.0E-10
sp|Q9KV66|DUSB_VIBCH tRNA-dihydrouridine synthase B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusB PE=3 SV=2 325 623 1.0E-09
sp|P53720|DUS2_YEAST tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 324 552 3.0E-09
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 307 641 3.0E-09
sp|Q08111|DUS_RHOCB Probable tRNA-dihydrouridine synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=dus PE=3 SV=1 295 617 4.0E-09
sp|Q87N01|DUSC_VIBPA tRNA-dihydrouridine(16) synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusC PE=3 SV=1 398 606 9.0E-09
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 326 523 2.0E-08
sp|Q8ZGV2|DUSC_YERPE tRNA-dihydrouridine(16) synthase OS=Yersinia pestis GN=dusC PE=3 SV=2 429 606 3.0E-08
sp|Q8DAH1|DUSC_VIBVU tRNA-dihydrouridine(16) synthase OS=Vibrio vulnificus (strain CMCP6) GN=dusC PE=3 SV=2 429 606 3.0E-08
sp|Q88LF2|DUSC_PSEPK tRNA-dihydrouridine(16) synthase OS=Pseudomonas putida (strain KT2440) GN=dusC PE=3 SV=1 394 606 3.0E-08
sp|Q9HZ95|DUSC_PSEAE tRNA-dihydrouridine(16) synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusC PE=3 SV=1 428 612 3.0E-08
sp|Q7XT07|DUS3L_ORYSJ tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Oryza sativa subsp. japonica GN=Os04g0117600 PE=2 SV=2 60 197 5.0E-08
sp|Q8C2P3|DUS1L_MOUSE tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 357 610 7.0E-08
sp|Q8K582|DUS1L_RAT tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 357 610 9.0E-08
sp|Q8Z5B2|DUSC_SALTI tRNA-dihydrouridine(16) synthase OS=Salmonella typhi GN=dusC PE=3 SV=1 429 606 1.0E-07
sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 357 610 1.0E-07
sp|Q8XEC6|DUSC_ECO57 tRNA-dihydrouridine(16) synthase OS=Escherichia coli O157:H7 GN=dusC PE=3 SV=1 429 635 2.0E-07
sp|Q8FFV5|DUSC_ECOL6 tRNA-dihydrouridine(16) synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusC PE=3 SV=2 429 606 2.0E-07
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 319 614 2.0E-07
sp|Q7UC91|DUSC_SHIFL tRNA-dihydrouridine(16) synthase OS=Shigella flexneri GN=dusC PE=3 SV=1 429 606 2.0E-07
sp|Q8ZNM4|DUSC_SALTY tRNA-dihydrouridine(16) synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusC PE=3 SV=1 429 606 2.0E-07
sp|Q884C6|DUSC_PSESM tRNA-dihydrouridine(16) synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dusC PE=3 SV=1 428 616 3.0E-07
sp|P33371|DUSC_ECOLI tRNA-dihydrouridine(16) synthase OS=Escherichia coli (strain K12) GN=dusC PE=1 SV=1 429 606 7.0E-07
sp|A8PTG4|DUS3_MALGO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=DUS3 PE=3 SV=1 58 169 1.0E-06
sp|Q9T0J6|DUS3L_ARATH tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Arabidopsis thaliana GN=At4g38890 PE=1 SV=2 19 205 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3629
MPDEEEIQIRAESNGGEFVSDERAAKRLKMDVPAEAEDANPQTQPPADAEVKATQDRRSGLAPVKKEYLLDVSSL
RIAASDAVDDDEAEARGAVNEPDTGGRDKKREKKKKGQNTERSFGKFDDAIRLCSSRALYPEFSPRECRFGDRCK
MSHDLRSYLAEGRRADLETFDGKCPVFEQYGSCPSGWRCRFVKSHMDEVTHDDGRTELVLRAAPATKDVPDKDKV
DEKNGDEEPSFEQEDRRHGVINVISISDKILLNRKRLDFSKADKYITWMNHEAEINSDFHHRRKTQSPKSIDDLR
ARFVDPPFKPSEKRRLYFGPETPTLAPLTTQGNLPFRRLCVELGCQLTYSEMAMSMPLLQGSKADWTLLRAHESE
MTPPRFDPGRTIVFDNYVNADDVKFGAQISGNQPWAVIKAADALQRFCPRLRLIDLNCGCPIDMVFKSGGGSALL
ESQGKMERMVRGMNAISGSIPITAKIRTGVKGNRPVATQVLGRLAFGAREHRERLGAPGCAAVTLHGRSREQRYT
KRADWSYIAECAALVASYNSKRGALTDTAAAPDESSLPNSVDGRMYFIGNGDCYSHADYFSHIEKARVDTVMIGR
GALIKPWIFEEIEKGQYLDKSSTQRLAYIERFVRYGLDTWGSDELGIGFTRRFLLEWLSFAHRYLPIGLLEHLPP
NINDRPPAYRGRDELETLMASPNYKDWIKISEMFLGPVQSGFQFQPKHRSNAYEAEG*
Coding >Ophun1|3629
ATGCCTGACGAAGAAGAAATCCAGATTCGAGCAGAGAGCAACGGAGGCGAATTTGTGTCGGACGAACGAGCTGCG
AAGCGCCTTAAGATGGACGTTCCAGCCGAAGCTGAAGATGCAAATCCTCAGACCCAACCTCCAGCCGACGCCGAA
GTCAAGGCTACCCAAGATCGCCGCTCTGGGTTGGCCCCGGTTAAGAAAGAATACCTTCTCGACGTTTCTTCTCTG
AGAATCGCCGCCTCGGATGCGGTCGACGATGACGAGGCTGAGGCCCGCGGTGCTGTCAACGAACCCGACACTGGT
GGCAGAGACAAGAAGAGGGAGAAGAAGAAGAAAGGCCAAAACACGGAGCGCTCTTTCGGCAAATTCGACGATGCC
ATCCGTCTCTGCAGCAGTAGAGCCCTCTACCCTGAATTCTCGCCGCGCGAGTGCAGGTTTGGTGACCGCTGCAAG
ATGAGCCACGATCTCCGATCCTATCTCGCAGAGGGCCGACGCGCAGACCTCGAAACCTTTGACGGCAAGTGTCCC
GTCTTCGAGCAATATGGCTCGTGCCCGTCCGGCTGGAGATGCCGCTTCGTCAAGAGCCATATGGACGAGGTGACG
CATGACGACGGCCGAACCGAGCTTGTCCTGCGAGCTGCACCCGCTACCAAAGACGTCCCGGACAAGGACAAGGTC
GATGAGAAGAATGGTGACGAGGAGCCTAGCTTCGAGCAGGAGGATCGCAGACATGGTGTGATCAACGTCATCAGT
ATTTCCGACAAGATTCTGCTGAATCGCAAGCGACTTGACTTCTCCAAAGCCGACAAGTATATAACATGGATGAAC
CATGAGGCGGAGATCAATTCCGATTTCCACCATCGTCGCAAGACGCAATCCCCCAAGTCAATCGACGATCTTCGC
GCCCGTTTCGTCGACCCGCCCTTCAAGCCCTCGGAGAAACGACGCCTCTACTTTGGCCCTGAGACGCCCACGTTG
GCGCCTCTCACGACGCAGGGAAACCTGCCTTTCCGCCGGCTCTGCGTCGAGCTGGGCTGCCAACTGACGTATTCG
GAGATGGCTATGAGCATGCCGTTGCTTCAGGGCTCCAAGGCGGATTGGACGCTGCTCCGAGCTCACGAATCGGAA
ATGACGCCGCCTCGATTCGACCCGGGCCGGACTATCGTCTTTGATAACTACGTCAACGCCGACGACGTCAAGTTC
GGCGCCCAGATCTCCGGCAACCAGCCGTGGGCGGTGATCAAGGCAGCCGACGCCCTGCAGCGCTTCTGCCCGCGC
CTTCGCCTTATAGATCTCAACTGCGGCTGCCCCATCGACATGGTATTCAAGTCTGGCGGCGGCTCGGCCTTGCTC
GAGTCGCAAGGCAAGATGGAGCGAATGGTTCGCGGGATGAACGCCATATCGGGCTCCATCCCTATCACAGCCAAG
ATCCGCACCGGCGTCAAGGGCAACCGGCCCGTGGCGACCCAGGTGCTGGGCAGGCTGGCTTTTGGGGCCCGCGAG
CATCGAGAGCGTCTCGGAGCCCCCGGTTGCGCGGCCGTAACGCTTCATGGCCGCAGCCGCGAGCAGCGCTACACC
AAGCGAGCCGACTGGTCCTACATCGCCGAGTGCGCCGCCCTCGTCGCCAGCTACAACTCGAAGCGCGGCGCCCTC
ACCGACACGGCTGCCGCCCCGGACGAGAGCTCGCTGCCCAACAGCGTAGACGGCCGCATGTACTTCATCGGCAAC
GGCGACTGCTACTCCCACGCCGACTACTTCTCTCACATCGAAAAGGCCCGCGTCGACACCGTCATGATCGGCCGC
GGCGCCCTCATCAAGCCCTGGATCTTCGAGGAGATTGAGAAGGGCCAGTACCTCGACAAGTCGTCGACGCAGCGC
CTGGCCTACATCGAACGCTTCGTCCGCTACGGTCTCGACACCTGGGGCTCCGACGAGCTCGGCATTGGCTTCACG
CGTCGCTTCCTCCTCGAGTGGCTCAGCTTCGCCCATCGCTACCTCCCCATCGGTCTTCTCGAGCATCTGCCGCCC
AATATCAACGACAGGCCCCCTGCCTACCGCGGACGCGACGAGCTGGAGACGCTGATGGCCTCGCCCAACTACAAG
GACTGGATCAAGATCTCCGAGATGTTCCTCGGCCCCGTCCAGTCTGGCTTCCAGTTCCAGCCCAAGCATCGATCC
AACGCCTACGAAGCCGAAGGTTGA
Transcript >Ophun1|3629
ATGCCTGACGAAGAAGAAATCCAGATTCGAGCAGAGAGCAACGGAGGCGAATTTGTGTCGGACGAACGAGCTGCG
AAGCGCCTTAAGATGGACGTTCCAGCCGAAGCTGAAGATGCAAATCCTCAGACCCAACCTCCAGCCGACGCCGAA
GTCAAGGCTACCCAAGATCGCCGCTCTGGGTTGGCCCCGGTTAAGAAAGAATACCTTCTCGACGTTTCTTCTCTG
AGAATCGCCGCCTCGGATGCGGTCGACGATGACGAGGCTGAGGCCCGCGGTGCTGTCAACGAACCCGACACTGGT
GGCAGAGACAAGAAGAGGGAGAAGAAGAAGAAAGGCCAAAACACGGAGCGCTCTTTCGGCAAATTCGACGATGCC
ATCCGTCTCTGCAGCAGTAGAGCCCTCTACCCTGAATTCTCGCCGCGCGAGTGCAGGTTTGGTGACCGCTGCAAG
ATGAGCCACGATCTCCGATCCTATCTCGCAGAGGGCCGACGCGCAGACCTCGAAACCTTTGACGGCAAGTGTCCC
GTCTTCGAGCAATATGGCTCGTGCCCGTCCGGCTGGAGATGCCGCTTCGTCAAGAGCCATATGGACGAGGTGACG
CATGACGACGGCCGAACCGAGCTTGTCCTGCGAGCTGCACCCGCTACCAAAGACGTCCCGGACAAGGACAAGGTC
GATGAGAAGAATGGTGACGAGGAGCCTAGCTTCGAGCAGGAGGATCGCAGACATGGTGTGATCAACGTCATCAGT
ATTTCCGACAAGATTCTGCTGAATCGCAAGCGACTTGACTTCTCCAAAGCCGACAAGTATATAACATGGATGAAC
CATGAGGCGGAGATCAATTCCGATTTCCACCATCGTCGCAAGACGCAATCCCCCAAGTCAATCGACGATCTTCGC
GCCCGTTTCGTCGACCCGCCCTTCAAGCCCTCGGAGAAACGACGCCTCTACTTTGGCCCTGAGACGCCCACGTTG
GCGCCTCTCACGACGCAGGGAAACCTGCCTTTCCGCCGGCTCTGCGTCGAGCTGGGCTGCCAACTGACGTATTCG
GAGATGGCTATGAGCATGCCGTTGCTTCAGGGCTCCAAGGCGGATTGGACGCTGCTCCGAGCTCACGAATCGGAA
ATGACGCCGCCTCGATTCGACCCGGGCCGGACTATCGTCTTTGATAACTACGTCAACGCCGACGACGTCAAGTTC
GGCGCCCAGATCTCCGGCAACCAGCCGTGGGCGGTGATCAAGGCAGCCGACGCCCTGCAGCGCTTCTGCCCGCGC
CTTCGCCTTATAGATCTCAACTGCGGCTGCCCCATCGACATGGTATTCAAGTCTGGCGGCGGCTCGGCCTTGCTC
GAGTCGCAAGGCAAGATGGAGCGAATGGTTCGCGGGATGAACGCCATATCGGGCTCCATCCCTATCACAGCCAAG
ATCCGCACCGGCGTCAAGGGCAACCGGCCCGTGGCGACCCAGGTGCTGGGCAGGCTGGCTTTTGGGGCCCGCGAG
CATCGAGAGCGTCTCGGAGCCCCCGGTTGCGCGGCCGTAACGCTTCATGGCCGCAGCCGCGAGCAGCGCTACACC
AAGCGAGCCGACTGGTCCTACATCGCCGAGTGCGCCGCCCTCGTCGCCAGCTACAACTCGAAGCGCGGCGCCCTC
ACCGACACGGCTGCCGCCCCGGACGAGAGCTCGCTGCCCAACAGCGTAGACGGCCGCATGTACTTCATCGGCAAC
GGCGACTGCTACTCCCACGCCGACTACTTCTCTCACATCGAAAAGGCCCGCGTCGACACCGTCATGATCGGCCGC
GGCGCCCTCATCAAGCCCTGGATCTTCGAGGAGATTGAGAAGGGCCAGTACCTCGACAAGTCGTCGACGCAGCGC
CTGGCCTACATCGAACGCTTCGTCCGCTACGGTCTCGACACCTGGGGCTCCGACGAGCTCGGCATTGGCTTCACG
CGTCGCTTCCTCCTCGAGTGGCTCAGCTTCGCCCATCGCTACCTCCCCATCGGTCTTCTCGAGCATCTGCCGCCC
AATATCAACGACAGGCCCCCTGCCTACCGCGGACGCGACGAGCTGGAGACGCTGATGGCCTCGCCCAACTACAAG
GACTGGATCAAGATCTCCGAGATGTTCCTCGGCCCCGTCCAGTCTGGCTTCCAGTTCCAGCCCAAGCATCGATCC
AACGCCTACGAAGCCGAAGGTTGA
Gene >Ophun1|3629
ATGCCTGACGAAGAAGAAATCCAGATTCGAGCAGAGAGCAACGGAGGCGAATTTGTGTCGGACGAACGAGCTGCG
AAGCGCCTTAAGATGGACGTTCCAGCCGAAGCTGAAGATGCAAATCCTCAGACCCAACCTCCAGCCGACGCCGAA
GTCAAGGCTACCCAAGATCGCCGCTCTGGGTTGGCCCCGGTTAAGAAAGAGTAAGCTTCATCCGAGGACGAGCTG
CCTAGATAGTGCTGATAAAACCATCTGCAGATACCTTCTCGACGTTTCTTCTCTGAGAATCGCCGCCTCGGATGC
GGTCGACGATGACGAGGCTGAGGCCCGCGGTGCTGTCAACGAACCCGACACTGGTGGCAGAGACAAGAAGAGGGA
GAAGAAGAAGAAAGGCCAAAACACGGAGCGCTCTTTCGGCAAATTCGACGATGCCATCCGTCTCTGCAGCAGTAG
AGCCCTCTACCCTGAATTCTCGCCGCGCGAGTGCAGGTTTGGTGACCGCTGCAAGATGAGCCACGATCTCCGATC
CTATCTCGCAGAGGGCCGACGCGCAGACCTCGAAACCTTTGACGGCAAGTGTCCCGTCTTCGAGCAATATGGCTC
GTGCCCGTCCGGCTGGAGATGCCGCTTCGTCAAGAGCCATATGGACGAGGTGACGCATGACGACGGCCGAACCGA
GCTTGTCCTGCGAGCTGCACCCGCTACCAAAGACGTCCCGGACAAGGACAAGGTCGATGAGAAGAATGGTGACGA
GGAGCCTAGCTTCGAGCAGGAGGATCGCAGACATGGTGTGATCAACGTCATCAGTATTTCCGACAAGATTCTGCT
GAATCGCAAGCGACTTGACTTCTCCAAAGCCGACAAGTATATAACATGGATGAACCATGAGGCGGAGATCAATTC
CGATTTCCACCATCGTCGCAAGACGCAATCCCCCAAGTCAATCGACGATCTTCGCGCCCGTTTCGTCGACCCGCC
CTTCAAGCCCTCGGAGAAACGACGCCTCTACTTTGGCCCTGAGACGCCCACGTTGGCGCCTCTCACGACGCAGGG
AAACCTGCCTTTCCGCCGGCTCTGCGTCGAGCTGGGCTGCCAACTGACGTATTCGGAGATGGCTATGAGCATGCC
GTTGCTTCAGGGCTCCAAGGCGGATTGGACGCTGCTCCGAGCTCACGAATCGGAAATGACGCCGCCTCGATTCGA
CCCGGGCCGGACTATCGTCTTTGATAACTACGTCAACGCCGACGACGTCAAGTTCGGCGCCCAGATCTCCGGCAA
CCAGCCGTGGGCGGTGATCAAGGCAGCCGACGCCCTGCAGCGCTTCTGCCCGCGCCTTCGCCTTATAGATCTCAA
CTGCGGCTGCCCCATCGACATGGTATTCAAGTCTGGCGGCGGCTCGGCCTTGCTCGAGTCGCAAGGCAAGATGGA
GCGAATGGTTCGCGGGATGAACGCCATATCGGGCTCCATCCCTATCACAGCCAAGATCCGCACCGGCGTCAAGGG
CAACCGGCCCGTGGCGACCCAGGTGCTGGGCAGGCTGGCTTTTGGGGCCCGCGAGCATCGAGAGCGTCTCGGAGC
CCCCGGTTGCGCGGCCGTAACGCTTCATGGCCGCAGCCGCGAGCAGCGCTACACCAAGCGAGCCGACTGGTCCTA
CATCGCCGAGTGCGCCGCCCTCGTCGCCAGCTACAACTCGAAGCGCGGCGCCCTCACCGACACGGCTGCCGCCCC
GGACGAGAGCTCGCTGCCCAACAGCGTAGACGGCCGCATGTACTTCATCGGCAACGGCGACTGCTACTCCCACGC
CGACTACTTCTCTCACATCGAAAAGGCCCGCGTCGACACCGTCATGATCGGCCGCGGCGCCCTCATCAAGCCCTG
GATCTTCGAGGAGATTGAGAAGGGCCAGTACCTCGACAAGTCGTCGACGCAGCGCCTGGCCTACATCGAACGCTT
CGTCCGCTACGGTCTCGACACCTGGGGCTCCGACGAGCTCGGCATTGGCTTCACGCGTCGCTTCCTCCTCGAGTG
GCTCAGCTTCGCCCATCGCTACCTCCCCATCGGTCTTCTCGAGCATCTGCCGCCCAATATCAACGACAGGCCCCC
TGCCTACCGCGGACGCGACGAGCTGGAGACGCTGATGGCCTCGCCCAACTACAAGGACTGGATCAAGATCTCGTA
CGTCTTTTCTGCGTTCTGCCCCCCCCCCTCTTAAAATTGGATGAAGTGTGAGCTAACATGTGATGACCCGAACAC
AGCGAGATGTTCCTCGGCCCCGTCCAGTCTGGCTTCCAGTTCCAGCCCAAGCATCGATCCAACGCCTACGAAGCC
GAAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail