Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3627
Gene name
LocationContig_323:7720..10084
Strand+
Gene length (bp)2364
Transcript length (bp)2172
Coding sequence length (bp)2172
Protein length (aa) 724

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.4E-01 15 43
PF00400 WD40 WD domain, G-beta repeat 2.3E-03 56 90
PF00400 WD40 WD domain, G-beta repeat 1.5E-02 121 149
PF00400 WD40 WD domain, G-beta repeat 2.4E-01 156 190
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 1.9E-04 118 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 541 1.0E-102
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 1 192 2.0E-50
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 221 2.0E-39
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 202 4.0E-39
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 202 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 541 1.0E-102
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 1 192 2.0E-50
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 221 2.0E-39
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 202 4.0E-39
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 202 8.0E-38
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 1 191 4.0E-36
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 1 191 7.0E-36
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 316 541 1.0E-33
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 298 541 4.0E-31
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 312 541 9.0E-29
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 17 203 5.0E-28
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 13 203 9.0E-28
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 316 549 5.0E-27
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 13 203 2.0E-26
sp|Q6C553|HIR1_YARLI Protein HIR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIR1 PE=3 SV=2 17 190 3.0E-22
sp|Q61666|HIRA_MOUSE Protein HIRA OS=Mus musculus GN=Hira PE=1 SV=3 10 196 7.0E-22
sp|P79987|HIRA_CHICK Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 10 196 7.0E-22
sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIR1 PE=1 SV=3 17 203 7.0E-22
sp|P54198|HIRA_HUMAN Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 10 196 1.0E-21
sp|Q8QFR2|HIRA_XENLA Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 10 196 2.0E-21
sp|Q7RZI0|HIR1_NEUCR Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 13 190 2.0E-21
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 17 191 3.0E-21
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 17 191 3.0E-21
sp|Q6FVD3|HIR1_CANGA Protein HIR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIR1 PE=3 SV=1 13 203 7.0E-21
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 17 196 8.0E-21
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 11 342 8.0E-21
sp|O42611|HIRA_TAKRU Protein HIRA OS=Takifugu rubripes GN=hira PE=2 SV=1 10 196 2.0E-20
sp|Q6CXX3|HIR1_KLULA Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 17 203 3.0E-20
sp|Q4IBR4|HIR1_GIBZE Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 13 192 6.0E-20
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 17 192 1.0E-19
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 17 192 2.0E-19
sp|Q1DHE1|HIR1_COCIM Protein HIR1 OS=Coccidioides immitis (strain RS) GN=HIR1 PE=3 SV=1 13 213 3.0E-19
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 11 192 6.0E-19
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 17 192 7.0E-19
sp|Q0UNC6|HIR1_PHANO Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 13 342 5.0E-18
sp|Q4P4R3|HIR1_USTMA Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 17 196 7.0E-18
sp|Q74ZN0|HIR1_ASHGO Protein HIR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIR1 PE=3 SV=2 13 203 8.0E-18
sp|Q6BYU4|HIR1_DEBHA Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 11 190 8.0E-17
sp|Q5ACW8|HIR1_CANAL Protein HIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIR1 PE=3 SV=1 56 199 3.0E-16
sp|Q4WTC4|HIR1_ASPFU Protein hir1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hir1 PE=3 SV=1 32 213 3.0E-16
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 468 577 8.0E-16
sp|Q0CQ54|HIR1_ASPTN Protein hir1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hir1 PE=3 SV=1 17 192 5.0E-14
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 471 544 1.0E-12
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 11 201 2.0E-12
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 314 403 7.0E-12
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 15 201 7.0E-12
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 14 197 2.0E-11
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 15 212 2.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 198 2.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 17 197 3.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 198 3.0E-11
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 30 194 4.0E-11
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 15 201 4.0E-11
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 13 194 8.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 196 9.0E-11
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 13 194 9.0E-11
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 15 201 1.0E-10
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 14 227 2.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 8 197 2.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 2.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 16 194 3.0E-10
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 22 193 3.0E-10
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 17 366 3.0E-10
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 17 215 3.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 58 218 4.0E-10
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 17 197 4.0E-10
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 13 194 4.0E-10
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 17 207 5.0E-10
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 13 194 5.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 36 194 7.0E-10
sp|Q5ZMC3|WSDU1_CHICK WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 78 195 7.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 1 201 9.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 58 205 9.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 204 2.0E-09
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 58 205 2.0E-09
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 57 205 2.0E-09
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 57 205 2.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 206 3.0E-09
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 3.0E-09
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 30 201 3.0E-09
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 30 201 3.0E-09
sp|Q09589|HIRA_CAEEL Protein HIRA homolog OS=Caenorhabditis elegans GN=K10D2.1 PE=3 SV=2 67 191 3.0E-09
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 30 201 3.0E-09
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 30 201 3.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 30 194 4.0E-09
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 17 207 6.0E-09
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 16 190 7.0E-09
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 30 194 7.0E-09
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 22 361 1.0E-08
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 58 205 2.0E-08
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 58 205 2.0E-08
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 58 205 2.0E-08
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 58 205 2.0E-08
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 58 205 2.0E-08
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 17 207 2.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 17 201 3.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 14 196 3.0E-08
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 16 90 3.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 22 212 3.0E-08
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 6 194 4.0E-08
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 30 194 4.0E-08
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 17 195 4.0E-08
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 17 195 4.0E-08
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 58 194 4.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 30 191 5.0E-08
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 9 203 5.0E-08
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 30 194 5.0E-08
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 123 547 6.0E-08
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 25 201 6.0E-08
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 54 205 7.0E-08
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 11 201 7.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 22 212 7.0E-08
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 58 194 8.0E-08
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 14 212 8.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 9.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 203 1.0E-07
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 17 201 1.0E-07
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 7 194 1.0E-07
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 19 201 1.0E-07
sp|Q6BIR7|HIR2_DEBHA Protein HIR2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR2 PE=3 SV=2 29 226 1.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 30 194 1.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 14 212 1.0E-07
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 52 198 1.0E-07
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 123 541 2.0E-07
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 22 193 2.0E-07
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 29 190 2.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 17 201 2.0E-07
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 11 193 2.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 22 212 2.0E-07
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 11 202 2.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 36 193 2.0E-07
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 17 198 2.0E-07
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 11 198 2.0E-07
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 22 193 3.0E-07
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 22 193 3.0E-07
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 17 191 3.0E-07
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 25 201 3.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 17 192 3.0E-07
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 15 195 3.0E-07
sp|Q2GSM6|SEC13_CHAGB Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 30 191 3.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 57 190 3.0E-07
sp|P57737|CORO7_HUMAN Coronin-7 OS=Homo sapiens GN=CORO7 PE=1 SV=2 14 153 3.0E-07
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 22 195 3.0E-07
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 22 193 4.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 22 190 4.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 57 190 4.0E-07
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 17 212 4.0E-07
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 22 193 5.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 22 190 5.0E-07
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 58 201 5.0E-07
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 59 194 5.0E-07
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 13 196 5.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 17 193 6.0E-07
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 13 196 6.0E-07
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 13 196 6.0E-07
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 13 196 6.0E-07
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 13 196 6.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 17 198 6.0E-07
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 17 227 6.0E-07
sp|Q1DHE1|HIR1_COCIM Protein HIR1 OS=Coccidioides immitis (strain RS) GN=HIR1 PE=3 SV=1 123 541 7.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 22 192 7.0E-07
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 17 198 7.0E-07
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 13 196 7.0E-07
sp|Q0CHM0|SEC13_ASPTN Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 1 191 7.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 17 215 7.0E-07
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 32 202 7.0E-07
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 32 202 7.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 22 190 8.0E-07
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 17 194 9.0E-07
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 17 212 9.0E-07
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 12 192 9.0E-07
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 15 195 9.0E-07
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 15 216 9.0E-07
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 13 196 9.0E-07
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 22 196 9.0E-07
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 32 202 9.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 18 191 1.0E-06
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 17 207 1.0E-06
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 17 207 1.0E-06
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 17 207 1.0E-06
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 17 207 1.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 22 190 1.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 57 190 1.0E-06
sp|Q5RBW3|CORO7_PONAB Coronin-7 OS=Pongo abelii GN=CORO7 PE=2 SV=1 14 153 1.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 11 202 1.0E-06
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 30 198 1.0E-06
sp|Q7RZF5|SEC13_NEUCR Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 30 191 1.0E-06
sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 22 212 1.0E-06
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 17 227 1.0E-06
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 58 194 1.0E-06
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 13 201 1.0E-06
sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 22 212 1.0E-06
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 14 193 1.0E-06
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 17 207 2.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 56 214 2.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 15 195 2.0E-06
sp|Q92176|COR1A_BOVIN Coronin-1A OS=Bos taurus GN=CORO1A PE=1 SV=3 12 156 2.0E-06
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 22 195 2.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 15 195 2.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 15 216 2.0E-06
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 22 212 2.0E-06
sp|O13046|WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis GN=wdhd1 PE=1 SV=1 29 204 2.0E-06
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 53 190 2.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 11 202 2.0E-06
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 3 196 2.0E-06
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 8 205 2.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 3.0E-06
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 22 190 3.0E-06
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 15 194 3.0E-06
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 6 195 3.0E-06
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 58 194 3.0E-06
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 6 195 3.0E-06
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 22 193 3.0E-06
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 17 206 3.0E-06
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 17 205 4.0E-06
sp|O14301|YE85_SCHPO Uncharacterized WD repeat-containing protein C9G1.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.05 PE=3 SV=1 29 171 4.0E-06
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 8 205 4.0E-06
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 8 205 4.0E-06
sp|P53024|SEC13_PICPG Protein transport protein SEC13 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC13 PE=1 SV=3 17 197 4.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 30 198 5.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 17 207 5.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 15 201 5.0E-06
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 13 160 5.0E-06
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 52 370 5.0E-06
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 6 195 5.0E-06
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 24 213 5.0E-06
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 22 190 6.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 17 207 6.0E-06
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 7 190 6.0E-06
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 7 190 6.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 17 198 6.0E-06
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 17 192 6.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 17 198 6.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 11 202 6.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 17 198 7.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 56 190 7.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 8 193 7.0E-06
sp|Q2UG43|SEC13_ASPOR Protein transport protein sec13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec13 PE=3 SV=1 30 191 7.0E-06
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 8 205 7.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 30 204 8.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 26 190 8.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 54 208 8.0E-06
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 13 196 8.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 17 190 9.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 30 204 9.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 26 190 9.0E-06
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 71 214 1.0E-05
sp|Q2KJH4|WDR1_BOVIN WD repeat-containing protein 1 OS=Bos taurus GN=WDR1 PE=2 SV=3 54 171 1.0E-05
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 57 194 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4137
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1989
Ophiocordyceps australis map64 (Brazil) OphauB2|1901
Ophiocordyceps camponoti-floridani Ophcf2|02304
Ophiocordyceps camponoti-rufipedis Ophun1|3627 (this protein)
Ophiocordyceps kimflemingae Ophio5|7885
Ophiocordyceps subramaniannii Hirsu2|8388

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3627
MKATPIIINWHDQNAPIYSAHFEPSGKGRLATAGGDNHIRIWKLDSDGLDRKVEYLSTLTKHNQAVNVVRWAPKG
ETLASAGDDGNVILWVPTDLPSSALGSESHDDKESWRAKHMCRSSGAEIYDLAWSPDAAHFIIGSMDNIARIYNA
NTGTLVRQIAEHSHYVQGVAWDPLNEYIATQSSDRSVHIYSLRTKDGHYTLSHDDKPSRLVSHIKADMPPRRISS
SSPAPPDFGHRTQLSIIDSNTSAGSPTASAPGTPTSFAVPMNPPSVVSHSRRSSFSSRRSVSPAPSMPLPAVMPM
EASPKPHSTAVKNASLYANETLTSFFRRLTFTPDGSLLLTPSGQYQTQVQADKDAKPTYEIINTVYIYSRGGINK
PPIAHLPGHKKPSVVIKCSPTLYTLRQSSPSTKHITMDTSSAEEPLGPLPDPVSKPSSTPSMMDPPPPPGSAAMD
SPARLINAAGDASMSGPRSAFALPYRMVYAVATQDAVLLYDTQQKTAICIVSNLHCATFTDLAWSNDGLTLIITS
SDGFCSTLSFSSGELGEVYKGEVGPVKTQAGAVSASNHNTPTTNFAPSSPFPNGAHHHHQHHHQHHHPHHHQHRS
SVGSFTAPSPPASVAAVAQRPSSPTRSNSASSIATQSSLVPGGIVSNPPLIAGSVPGLTAAGGGKTVGKVGGVPM
TTPPETPRSTTGVKREASESEKEETKEPKRRRVAPTLVESKSIDSKPV*
Coding >Ophun1|3627
ATGAAGGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCCCCCATCTATTCGGCTCATTTCGAGCCCTCG
GGCAAGGGCCGTCTCGCTACCGCCGGCGGCGACAACCACATCCGCATCTGGAAGCTCGACTCGGATGGACTAGAC
CGCAAGGTCGAGTACCTCTCTACCCTAACCAAGCATAACCAGGCCGTCAACGTTGTTCGATGGGCACCCAAGGGC
GAAACGCTCGCCTCCGCCGGTGACGACGGCAACGTCATTCTCTGGGTGCCCACCGACCTGCCCTCGTCTGCCCTC
GGCTCCGAATCCCACGATGACAAGGAGTCGTGGCGAGCCAAACACATGTGCCGCTCCAGCGGTGCCGAGATTTAC
GACCTGGCCTGGTCTCCAGACGCTGCTCATTTCATCATAGGCAGCATGGACAACATCGCTCGGATATACAACGCC
AATACTGGCACGCTGGTTCGACAAATCGCCGAACACAGCCACTACGTTCAAGGCGTCGCCTGGGATCCCCTTAAC
GAGTACATCGCCACCCAGTCGTCGGACCGGTCCGTTCACATCTACTCGCTGAGGACAAAGGATGGCCATTACACG
CTCAGCCACGACGATAAGCCGTCGAGATTGGTCAGCCACATCAAGGCGGACATGCCTCCGCGTCGCATCTCGTCG
AGCAGTCCTGCGCCGCCCGACTTCGGTCATCGTACCCAGCTGTCCATCATTGACTCCAACACGTCGGCCGGCTCT
CCGACAGCTTCGGCGCCAGGGACTCCGACGTCGTTTGCCGTCCCTATGAACCCGCCTAGCGTCGTCAGCCACAGT
CGACGGTCCTCCTTCTCCTCACGCCGTTCCGTTTCGCCCGCACCCTCAATGCCTCTCCCCGCCGTCATGCCGATG
GAGGCGTCGCCCAAGCCCCATTCGACGGCCGTCAAGAACGCTAGCCTCTATGCCAATGAGACACTGACATCCTTT
TTTCGCCGCCTCACTTTTACTCCGGACGGCAGCCTTCTCCTGACGCCTTCGGGGCAGTATCAGACTCAGGTTCAG
GCAGACAAGGACGCGAAGCCGACGTACGAGATCATCAACACCGTCTACATCTACTCGCGGGGCGGCATCAATAAG
CCTCCCATTGCCCATCTGCCGGGCCACAAGAAGCCATCGGTCGTCATCAAGTGCTCCCCCACGCTGTATACGCTT
CGCCAGTCGTCGCCGTCGACAAAGCACATCACCATGGACACGTCGTCGGCCGAAGAGCCTCTGGGGCCGCTTCCT
GATCCCGTATCAAAACCGTCATCGACGCCCTCGATGATGGATCCTCCTCCGCCGCCGGGCAGCGCTGCTATGGAT
TCGCCGGCCAGGTTGATCAACGCCGCCGGAGACGCCTCCATGTCCGGGCCGAGATCGGCTTTTGCGCTGCCGTAC
AGGATGGTGTATGCCGTGGCTACGCAAGACGCCGTCCTCCTCTACGATACGCAGCAAAAGACGGCGATATGCATC
GTCAGCAACTTGCACTGCGCTACATTCACCGATCTCGCATGGTCGAATGACGGTCTCACTTTGATCATCACATCT
TCCGACGGCTTCTGCTCTACTCTCTCATTCAGCTCGGGCGAGCTGGGCGAAGTCTACAAGGGAGAGGTCGGACCG
GTCAAGACTCAGGCCGGGGCGGTCTCGGCGTCGAACCACAATACACCGACGACAAACTTTGCACCATCGTCACCG
TTTCCTAATGGCGCGCATCATCATCACCAGCATCATCATCAGCATCACCACCCACATCATCATCAGCACCGCAGT
TCGGTGGGCTCGTTTACGGCACCTTCGCCGCCAGCCTCGGTGGCAGCCGTTGCGCAGCGGCCGTCGTCGCCGACG
CGATCTAATTCGGCGTCTTCGATAGCAACGCAGTCGTCGCTCGTGCCCGGTGGTATCGTGAGCAATCCGCCGCTC
ATCGCCGGCAGCGTGCCTGGACTCACGGCGGCCGGCGGGGGCAAGACGGTCGGCAAGGTCGGAGGGGTGCCGATG
ACGACACCGCCGGAGACGCCTCGCAGCACGACGGGCGTCAAGAGGGAGGCGAGCGAGAGCGAGAAGGAGGAAACA
AAAGAGCCCAAGAGGAGAAGGGTAGCGCCGACGCTGGTGGAGTCGAAGTCGATAGACTCGAAGCCGGTATGA
Transcript >Ophun1|3627
ATGAAGGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCCCCCATCTATTCGGCTCATTTCGAGCCCTCG
GGCAAGGGCCGTCTCGCTACCGCCGGCGGCGACAACCACATCCGCATCTGGAAGCTCGACTCGGATGGACTAGAC
CGCAAGGTCGAGTACCTCTCTACCCTAACCAAGCATAACCAGGCCGTCAACGTTGTTCGATGGGCACCCAAGGGC
GAAACGCTCGCCTCCGCCGGTGACGACGGCAACGTCATTCTCTGGGTGCCCACCGACCTGCCCTCGTCTGCCCTC
GGCTCCGAATCCCACGATGACAAGGAGTCGTGGCGAGCCAAACACATGTGCCGCTCCAGCGGTGCCGAGATTTAC
GACCTGGCCTGGTCTCCAGACGCTGCTCATTTCATCATAGGCAGCATGGACAACATCGCTCGGATATACAACGCC
AATACTGGCACGCTGGTTCGACAAATCGCCGAACACAGCCACTACGTTCAAGGCGTCGCCTGGGATCCCCTTAAC
GAGTACATCGCCACCCAGTCGTCGGACCGGTCCGTTCACATCTACTCGCTGAGGACAAAGGATGGCCATTACACG
CTCAGCCACGACGATAAGCCGTCGAGATTGGTCAGCCACATCAAGGCGGACATGCCTCCGCGTCGCATCTCGTCG
AGCAGTCCTGCGCCGCCCGACTTCGGTCATCGTACCCAGCTGTCCATCATTGACTCCAACACGTCGGCCGGCTCT
CCGACAGCTTCGGCGCCAGGGACTCCGACGTCGTTTGCCGTCCCTATGAACCCGCCTAGCGTCGTCAGCCACAGT
CGACGGTCCTCCTTCTCCTCACGCCGTTCCGTTTCGCCCGCACCCTCAATGCCTCTCCCCGCCGTCATGCCGATG
GAGGCGTCGCCCAAGCCCCATTCGACGGCCGTCAAGAACGCTAGCCTCTATGCCAATGAGACACTGACATCCTTT
TTTCGCCGCCTCACTTTTACTCCGGACGGCAGCCTTCTCCTGACGCCTTCGGGGCAGTATCAGACTCAGGTTCAG
GCAGACAAGGACGCGAAGCCGACGTACGAGATCATCAACACCGTCTACATCTACTCGCGGGGCGGCATCAATAAG
CCTCCCATTGCCCATCTGCCGGGCCACAAGAAGCCATCGGTCGTCATCAAGTGCTCCCCCACGCTGTATACGCTT
CGCCAGTCGTCGCCGTCGACAAAGCACATCACCATGGACACGTCGTCGGCCGAAGAGCCTCTGGGGCCGCTTCCT
GATCCCGTATCAAAACCGTCATCGACGCCCTCGATGATGGATCCTCCTCCGCCGCCGGGCAGCGCTGCTATGGAT
TCGCCGGCCAGGTTGATCAACGCCGCCGGAGACGCCTCCATGTCCGGGCCGAGATCGGCTTTTGCGCTGCCGTAC
AGGATGGTGTATGCCGTGGCTACGCAAGACGCCGTCCTCCTCTACGATACGCAGCAAAAGACGGCGATATGCATC
GTCAGCAACTTGCACTGCGCTACATTCACCGATCTCGCATGGTCGAATGACGGTCTCACTTTGATCATCACATCT
TCCGACGGCTTCTGCTCTACTCTCTCATTCAGCTCGGGCGAGCTGGGCGAAGTCTACAAGGGAGAGGTCGGACCG
GTCAAGACTCAGGCCGGGGCGGTCTCGGCGTCGAACCACAATACACCGACGACAAACTTTGCACCATCGTCACCG
TTTCCTAATGGCGCGCATCATCATCACCAGCATCATCATCAGCATCACCACCCACATCATCATCAGCACCGCAGT
TCGGTGGGCTCGTTTACGGCACCTTCGCCGCCAGCCTCGGTGGCAGCCGTTGCGCAGCGGCCGTCGTCGCCGACG
CGATCTAATTCGGCGTCTTCGATAGCAACGCAGTCGTCGCTCGTGCCCGGTGGTATCGTGAGCAATCCGCCGCTC
ATCGCCGGCAGCGTGCCTGGACTCACGGCGGCCGGCGGGGGCAAGACGGTCGGCAAGGTCGGAGGGGTGCCGATG
ACGACACCGCCGGAGACGCCTCGCAGCACGACGGGCGTCAAGAGGGAGGCGAGCGAGAGCGAGAAGGAGGAAACA
AAAGAGCCCAAGAGGAGAAGGGTAGCGCCGACGCTGGTGGAGTCGAAGTCGATAGACTCGAAGCCGGTATGA
Gene >Ophun1|3627
ATGAAGGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCCCCCATCTATTCGGCTCATTTCGAGCCCTCG
GGCAAGGGCCGTCTCGCTACCGCCGGCGGCGACAACCACATCCGCATCTGGAAGCTCGACTCGGATGGACTAGAC
CGCAAGGTCGAGTACCTCTCTACCCTAACCAAGCATAACCAGGCCGTCAACGTTGTTCGATGGGCACCCAAGGGT
AAGTCATCTCGGAGATTCCAGTGGTTTTCTGCCTGGCTGATCCCTGCTCCCTGATTGCCAACCCACAGGCGAAAC
GCTCGCCTCCGCCGGTGACGACGGCAACGTCATTCTCTGGGTGCCCACCGACCTGCCCTCGTCTGCCCTCGGCTC
CGAATCCCACGATGACAAGGAGTCGTGGCGAGCCAAACACATGTGCCGCTCCAGCGGTGCCGAGATTTACGACCT
GGCCTGGTCTCCAGACGCTGCTCATTTCATCATAGGCAGCATGGACAACATCGCTCGGATATACAACGCCAATAC
TGGTCAGCAGCCCGCCGCCGCCGCACGCCGTCCAGCTTCCAGGGCGTCCTTCGACTGACATTGCTCACTAGGCAC
GCTGGTTCGACAAATCGCCGAACACAGCCACTACGTTCAAGGCGTCGCCTGGGATCCCCTTAACGAGTACATCGC
CACCCAGTCGTCGGACCGGTCCGTTCACATCTACTCGCTGAGGACAAAGGATGGCCATTACACGCTCAGCCACGA
CGATAAGCCGTCGAGATTGGTCAGCCACATCAAGGCGGACATGCCTCCGCGTCGCATCTCGTCGAGCAGTCCTGC
GCCGCCCGACTTCGGTCATCGTACCCAGCTGTCCATCATTGACTCCAACACGTCGGCCGGCTCTCCGACAGCTTC
GGCGCCAGGGACTCCGACGTCGTTTGCCGTCCCTATGAACCCGCCTAGCGTCGTCAGCCACAGTCGACGGTCCTC
CTTCTCCTCACGCCGTTCCGTTTCGCCCGCACCCTCAATGCCTCTCCCCGCCGTCATGCCGATGGAGGCGTCGCC
CAAGCCCCATTCGACGGCCGTCAAGAACGCTAGCCTCTATGCCAATGAGACACTGACATCCTTTTTTCGCCGCCT
CACTTTTACTCCGGACGGCAGCCTTCTCCTGACGCCTTCGGGGCAGTATCAGACTCAGGTTCAGGCAGACAAGGA
CGCGAAGCCGACGTACGAGATCATCAACACCGTCTACATCTACTCGCGGGGCGGCATCAATAAGCCTCCCATTGC
CCATCTGCCGGGCCACAAGAAGCCATCGGTCGTCATCAAGTGCTCCCCCACGCTGTATACGCTTCGCCAGTCGTC
GCCGTCGACAAAGCACATCACCATGGACACGTCGTCGGCCGAAGAGCCTCTGGGGCCGCTTCCTGATCCCGTATC
AAAACCGTCATCGACGCCCTCGATGATGGATCCTCCTCCGCCGCCGGGCAGCGCTGCTATGGATTCGCCGGCCAG
GTTGATCAACGCCGCCGGAGACGCCTCCATGTCCGGGCCGAGATCGGCTTTTGCGCTGCCGTACAGGATGGTGTA
TGCCGTGGCTACGCAAGACGCCGTCCTCCTCTACGATACGCAGCAAAAGACGGCGATATGCATCGTCAGCAACTT
GCACTGCGCTACATTCACCGATCTCGCATGGTAAGGTCGTTGGCTACCCCTATCAGTTGTCGAGAAGCTAAAGCT
GGGGCCAGGTCGAATGACGGTCTCACTTTGATCATCACATCTTCCGACGGCTTCTGCTCTACTCTCTCATTCAGC
TCGGGCGAGCTGGGCGAAGTCTACAAGGGAGAGGTCGGACCGGTCAAGACTCAGGCCGGGGCGGTCTCGGCGTCG
AACCACAATACACCGACGACAAACTTTGCACCATCGTCACCGTTTCCTAATGGCGCGCATCATCATCACCAGCAT
CATCATCAGCATCACCACCCACATCATCATCAGCACCGCAGTTCGGTGGGCTCGTTTACGGCACCTTCGCCGCCA
GCCTCGGTGGCAGCCGTTGCGCAGCGGCCGTCGTCGCCGACGCGATCTAATTCGGCGTCTTCGATAGCAACGCAG
TCGTCGCTCGTGCCCGGTGGTATCGTGAGCAATCCGCCGCTCATCGCCGGCAGCGTGCCTGGACTCACGGCGGCC
GGCGGGGGCAAGACGGTCGGCAAGGTCGGAGGGGTGCCGATGACGACACCGCCGGAGACGCCTCGCAGCACGACG
GGCGTCAAGAGGGAGGCGAGCGAGAGCGAGAAGGAGGAAACAAAAGAGCCCAAGAGGAGAAGGGTAGCGCCGACG
CTGGTGGAGTCGAAGTCGATAGACTCGAAGCCGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail