Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3622
Gene name
LocationContig_322:13479..14623
Strand+
Gene length (bp)1144
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 4.6E-30 29 198
PF16200 Band_7_C C-terminal region of band_7 6.9E-22 248 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60121|YH77_SCHPO Uncharacterized protein C16G5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.07c PE=3 SV=1 23 314 6.0E-124
sp|Q32LL2|STML2_BOVIN Stomatin-like protein 2, mitochondrial OS=Bos taurus GN=STOML2 PE=2 SV=1 20 312 1.0E-119
sp|Q9UJZ1|STML2_HUMAN Stomatin-like protein 2, mitochondrial OS=Homo sapiens GN=STOML2 PE=1 SV=1 20 312 2.0E-119
sp|Q99JB2|STML2_MOUSE Stomatin-like protein 2, mitochondrial OS=Mus musculus GN=Stoml2 PE=1 SV=1 20 312 7.0E-119
sp|Q4FZT0|STML2_RAT Stomatin-like protein 2, mitochondrial OS=Rattus norvegicus GN=Stoml2 PE=1 SV=1 20 312 9.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60121|YH77_SCHPO Uncharacterized protein C16G5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.07c PE=3 SV=1 23 314 6.0E-124
sp|Q32LL2|STML2_BOVIN Stomatin-like protein 2, mitochondrial OS=Bos taurus GN=STOML2 PE=2 SV=1 20 312 1.0E-119
sp|Q9UJZ1|STML2_HUMAN Stomatin-like protein 2, mitochondrial OS=Homo sapiens GN=STOML2 PE=1 SV=1 20 312 2.0E-119
sp|Q99JB2|STML2_MOUSE Stomatin-like protein 2, mitochondrial OS=Mus musculus GN=Stoml2 PE=1 SV=1 20 312 7.0E-119
sp|Q4FZT0|STML2_RAT Stomatin-like protein 2, mitochondrial OS=Rattus norvegicus GN=Stoml2 PE=1 SV=1 20 312 9.0E-119
sp|P0DKS0|QMCA_WIGBR Protein QmcA OS=Wigglesworthia glossinidia brevipalpis GN=qmcA PE=3 SV=1 29 301 3.0E-58
sp|P0AA56|QMCA_SHIFL Protein QmcA OS=Shigella flexneri GN=qmcA PE=3 SV=1 26 288 7.0E-56
sp|P0AA53|QMCA_ECOLI Protein QmcA OS=Escherichia coli (strain K12) GN=qmcA PE=1 SV=1 26 288 7.0E-56
sp|P0AA54|QMCA_ECOL6 Protein QmcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=qmcA PE=3 SV=1 26 288 7.0E-56
sp|P0AA55|QMCA_ECO57 Protein QmcA OS=Escherichia coli O157:H7 GN=qmcA PE=3 SV=1 26 288 7.0E-56
sp|P72655|Y1128_SYNY3 Uncharacterized protein slr1128 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1128 PE=3 SV=1 24 273 1.0E-53
sp|O26788|Y692_METTH Uncharacterized protein MTH_692 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_692 PE=3 SV=1 36 331 4.0E-50
sp|P9WPR9|Y1488_MYCTU Uncharacterized protein Rv1488 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1488 PE=1 SV=1 26 256 1.0E-41
sp|P9WPR8|Y1488_MYCTO Uncharacterized protein MT1533.2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1533.2 PE=3 SV=1 26 256 1.0E-41
sp|P63694|Y1524_MYCBO Uncharacterized protein Mb1524 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1524 PE=3 SV=1 26 256 1.0E-41
sp|O28852|Y1420_ARCFU Uncharacterized protein AF_1420 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1420 PE=3 SV=1 26 208 1.0E-33
sp|Q58237|Y827_METJA Uncharacterized protein MJ0827 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0827 PE=3 SV=1 28 199 5.0E-33
sp|Q9V0Y1|PSTOM_PYRAB Stomatin homolog PYRAB06580 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06580 PE=3 SV=1 26 208 2.0E-25
sp|O59180|PSTOM_PYRHO Stomatin homolog PH1511 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1511 PE=1 SV=1 26 208 2.0E-24
sp|Q6PE84|STML3_MOUSE Stomatin-like protein 3 OS=Mus musculus GN=Stoml3 PE=1 SV=2 36 216 8.0E-22
sp|Q19200|STO1_CAEEL Stomatin-1 OS=Caenorhabditis elegans GN=sto-1 PE=3 SV=2 25 198 1.0E-21
sp|Q8TAV4|STML3_HUMAN Stomatin-like protein 3 OS=Homo sapiens GN=STOML3 PE=2 SV=1 36 216 2.0E-21
sp|P27105|STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 36 219 3.0E-20
sp|P54116|STOM_MOUSE Erythrocyte band 7 integral membrane protein OS=Mus musculus GN=Stom PE=1 SV=3 25 172 4.0E-19
sp|Q16TM5|BND7A_AEDAE Band 7 protein AAEL010189 OS=Aedes aegypti GN=AAEL010189 PE=3 SV=1 49 202 2.0E-18
sp|Q7PPU9|BND7A_ANOGA Band 7 protein AGAP004871 OS=Anopheles gambiae GN=AGAP004871 PE=3 SV=3 49 202 3.0E-18
sp|Q20657|STO3_CAEEL Stomatin-3 OS=Caenorhabditis elegans GN=sto-3 PE=3 SV=1 25 198 6.0E-18
sp|Q19958|STO2_CAEEL Stomatin-2 OS=Caenorhabditis elegans GN=sto-2 PE=3 SV=4 49 202 1.0E-17
sp|Q9VZA4|BND7A_DROME Band 7 protein CG42540 OS=Drosophila melanogaster GN=CG42540 PE=2 SV=2 20 202 3.0E-17
sp|Q22165|STO4_CAEEL Stomatin-4 OS=Caenorhabditis elegans GN=sto-4 PE=3 SV=2 49 199 4.0E-17
sp|Q27433|MEC2_CAEEL Mechanosensory protein 2 OS=Caenorhabditis elegans GN=mec-2 PE=1 SV=1 14 208 6.0E-17
sp|Q21190|UNC1_CAEEL Protein unc-1 OS=Caenorhabditis elegans GN=unc-1 PE=3 SV=2 36 202 2.0E-16
sp|Q8K4G9|PODO_RAT Podocin OS=Rattus norvegicus GN=Nphs2 PE=1 SV=2 25 199 1.0E-15
sp|Q91X05|PODO_MOUSE Podocin OS=Mus musculus GN=Nphs2 PE=1 SV=2 25 199 2.0E-15
sp|Q5UP73|YR614_MIMIV Putative band 7 family protein R614 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R614 PE=3 SV=1 20 202 1.0E-14
sp|Q9NP85|PODO_HUMAN Podocin OS=Homo sapiens GN=NPHS2 PE=1 SV=1 25 193 9.0E-13
sp|P0ABC7|HFLK_ECOLI Modulator of FtsH protease HflK OS=Escherichia coli (strain K12) GN=hflK PE=1 SV=1 36 231 3.0E-09
sp|P0ABC8|HFLK_ECO57 Protein HflK OS=Escherichia coli O157:H7 GN=hflK PE=3 SV=1 36 231 3.0E-09
sp|Q9SRH6|HIR3_ARATH Hypersensitive-induced response protein 3 OS=Arabidopsis thaliana GN=HIR3 PE=1 SV=1 28 236 7.0E-09
sp|P44546|HFLK_HAEIN Protein HflK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hflK PE=3 SV=1 36 235 1.0E-08
sp|Q9UBI4|STML1_HUMAN Stomatin-like protein 1 OS=Homo sapiens GN=STOML1 PE=1 SV=1 26 165 2.0E-08
sp|Q8CI66|STML1_MOUSE Stomatin-like protein 1 OS=Mus musculus GN=Stoml1 PE=2 SV=1 26 165 2.0E-08
sp|Q9KV09|HFLK_VIBCH Protein HflK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hflK PE=3 SV=1 36 231 3.0E-07
sp|O51221|HFLK_BORBU Protein HflK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=hflK PE=3 SV=1 30 233 4.0E-07
sp|Q9FM19|HIR1_ARATH Hypersensitive-induced response protein 1 OS=Arabidopsis thaliana GN=HIR1 PE=1 SV=1 29 303 5.0E-07
sp|Q9FHM7|HIR4_ARATH Hypersensitive-induced response protein 4 OS=Arabidopsis thaliana GN=HIR4 PE=1 SV=1 29 303 5.0E-06
sp|P40605|HFLK_VIBPA Protein HflK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hflK PE=3 SV=1 36 231 5.0E-06
sp|P57630|HFLC_BUCAI Protein HflC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hflC PE=3 SV=1 46 240 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2800
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6322
Ophiocordyceps australis map64 (Brazil) OphauB2|1811
Ophiocordyceps camponoti-floridani Ophcf2|01499
Ophiocordyceps camponoti-rufipedis Ophun1|3622 (this protein)
Ophiocordyceps kimflemingae Ophio5|1662
Ophiocordyceps subramaniannii Hirsu2|4490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3622
MPPAGFSSSPMPSYFQKPRLPANTVVRFVPQQTAWIVERMGKFNRILEPGLALLVPFLDRIAYVKSLKEVAIEIP
SQSAITADNVTLDLDGVLFTRVFDAYKASYGVEDAEYAISQLAQTTMRSEIGQLSLDHVLKERAALNTNITAAIN
DAAEAWGVTCLRYEIRDIHAPAAVVEAMHRQVTAERSKRAEILDSEGQRQSAINIAEGKKQSVILASEALRAERI
NEADGEAEAILLKARATAQGIDAVARSIHEGAEGATGAISLSVAEKYVESFGRLAKEGTAIVVPGNVGDIGSMIA
TGLSVYGKVSQAQAGSMAKAALESSTMEQPATGGPQSAEDAVSARRRAMKETVLDGFDKTAAKK*
Coding >Ophun1|3622
ATGCCCCCGGCTGGCTTCTCGTCGAGTCCGATGCCGTCGTACTTTCAGAAGCCGCGGCTGCCGGCCAACACGGTG
GTGCGCTTCGTTCCGCAGCAGACGGCGTGGATTGTGGAGCGCATGGGCAAGTTTAACCGCATCCTTGAGCCGGGC
TTGGCTCTCTTGGTGCCGTTTCTCGATCGCATTGCCTACGTCAAGAGCTTGAAGGAGGTGGCTATTGAAATTCCG
AGTCAGAGTGCCATCACGGCCGATAATGTGACGCTTGATCTGGATGGCGTGCTCTTTACGCGCGTCTTTGACGCT
TACAAGGCGAGCTACGGTGTTGAGGATGCCGAATACGCCATCTCCCAGCTCGCGCAGACGACGATGCGTTCCGAA
ATCGGCCAGCTTTCTCTCGATCACGTCCTCAAGGAGCGTGCGGCCCTCAACACGAACATCACCGCCGCCATCAAC
GACGCCGCCGAGGCCTGGGGCGTGACGTGCCTGCGCTACGAGATCCGCGATATTCACGCGCCTGCCGCTGTCGTC
GAGGCCATGCATCGCCAGGTGACGGCCGAGCGCTCCAAGCGGGCCGAGATTCTCGACTCTGAGGGGCAGCGGCAG
AGCGCCATCAACATTGCCGAGGGTAAAAAGCAGAGTGTCATTCTCGCCTCCGAGGCGCTGCGGGCGGAGCGCATC
AACGAGGCCGACGGTGAGGCCGAGGCTATCCTGCTCAAGGCACGCGCTACGGCACAGGGCATCGACGCCGTGGCT
CGCAGCATTCACGAGGGGGCAGAGGGCGCGACGGGGGCCATCAGCCTGTCGGTGGCGGAAAAGTACGTCGAGTCC
TTTGGCAGGCTGGCCAAGGAAGGGACCGCCATCGTCGTGCCTGGGAACGTGGGCGATATCGGCAGCATGATCGCC
ACCGGGCTCAGCGTCTACGGCAAAGTGAGCCAGGCGCAGGCGGGTTCCATGGCCAAGGCGGCTCTCGAGTCTTCG
ACCATGGAGCAGCCCGCGACGGGAGGGCCACAGAGCGCGGAAGATGCCGTGTCGGCGAGGCGGCGTGCCATGAAG
GAGACGGTTCTCGACGGCTTCGACAAGACAGCGGCCAAGAAGTAG
Transcript >Ophun1|3622
ATGCCCCCGGCTGGCTTCTCGTCGAGTCCGATGCCGTCGTACTTTCAGAAGCCGCGGCTGCCGGCCAACACGGTG
GTGCGCTTCGTTCCGCAGCAGACGGCGTGGATTGTGGAGCGCATGGGCAAGTTTAACCGCATCCTTGAGCCGGGC
TTGGCTCTCTTGGTGCCGTTTCTCGATCGCATTGCCTACGTCAAGAGCTTGAAGGAGGTGGCTATTGAAATTCCG
AGTCAGAGTGCCATCACGGCCGATAATGTGACGCTTGATCTGGATGGCGTGCTCTTTACGCGCGTCTTTGACGCT
TACAAGGCGAGCTACGGTGTTGAGGATGCCGAATACGCCATCTCCCAGCTCGCGCAGACGACGATGCGTTCCGAA
ATCGGCCAGCTTTCTCTCGATCACGTCCTCAAGGAGCGTGCGGCCCTCAACACGAACATCACCGCCGCCATCAAC
GACGCCGCCGAGGCCTGGGGCGTGACGTGCCTGCGCTACGAGATCCGCGATATTCACGCGCCTGCCGCTGTCGTC
GAGGCCATGCATCGCCAGGTGACGGCCGAGCGCTCCAAGCGGGCCGAGATTCTCGACTCTGAGGGGCAGCGGCAG
AGCGCCATCAACATTGCCGAGGGTAAAAAGCAGAGTGTCATTCTCGCCTCCGAGGCGCTGCGGGCGGAGCGCATC
AACGAGGCCGACGGTGAGGCCGAGGCTATCCTGCTCAAGGCACGCGCTACGGCACAGGGCATCGACGCCGTGGCT
CGCAGCATTCACGAGGGGGCAGAGGGCGCGACGGGGGCCATCAGCCTGTCGGTGGCGGAAAAGTACGTCGAGTCC
TTTGGCAGGCTGGCCAAGGAAGGGACCGCCATCGTCGTGCCTGGGAACGTGGGCGATATCGGCAGCATGATCGCC
ACCGGGCTCAGCGTCTACGGCAAAGTGAGCCAGGCGCAGGCGGGTTCCATGGCCAAGGCGGCTCTCGAGTCTTCG
ACCATGGAGCAGCCCGCGACGGGAGGGCCACAGAGCGCGGAAGATGCCGTGTCGGCGAGGCGGCGTGCCATGAAG
GAGACGGTTCTCGACGGCTTCGACAAGACAGCGGCCAAGAAGTAG
Gene >Ophun1|3622
ATGCCCCCGGCTGGCTTCTCGTCGAGTCCGATGCCGTCGTACTTTCAGAAGCCGCGGCTGCCGGCCAACACGGTG
GTGCGCTTCGTTCCGCAGCAGACGGCGTGGATTGTGGAGCGCATGGGCAAGTTTAACCGCATCCTTGAGCCGGGC
TTGGCTCTCTTGGTGCCGTTTCTCGATCGCATTGCCTACGTCAAGAGCTTGAAGGAGGTGGCTATTGAAATTCCG
AGTCAGAGTGCCATCACGGCCGATAATGTGACGCTTGATCTGGATGGCGTGCTCTTTACGCGCGTCTTTGACGCT
TACAAGGCGAGGTGCGTTGGCTTGCTTCATCATGCGAATTGGTCGCTCATGATATGGCAGCTACGGTGTTGAGGA
TGCCGAATACGCCATCTCCCAGCTCGCGCAGACGACGATGCGTTCCGAAATCGGCCAGCTTTCTCTCGATCACGT
CCTCAAGGAGCGTGCGGCCCTCAACACGAACATCACCGCCGCCATCAACGACGCCGCCGAGGCCTGGGGCGTGAC
GTGCCTGCGCTACGAGATCCGCGATATTCACGCGCCTGCCGCTGTCGTCGAGGCCATGCATCGCCAGGTGACGGC
CGAGCGCTCCAAGCGGGCCGAGATTCTCGACTCTGAGGGGCAGCGGCAGAGCGCCATCAACATTGCCGAGGGTAA
AAAGCAGAGTGTCATTCTCGCCTCCGAGGCGCTGCGGGCGGAGCGCATCAACGAGGCCGACGGTGAGGCCGAGGC
TATCCTGCTCAAGGCACGCGCTACGGCACAGGGCATCGACGCCGTGGCTCGCAGCATTCACGAGGGGGCAGAGGG
CGCGACGGGGGCCATCAGCCTGTCGGTGGCGGAAAAGTACGTCGAGTCCTTTGGCAGGCTGGCCAAGGAAGGGAC
CGCCATCGTCGTGCCTGGGAACGTGGGCGATATCGGCAGCATGATCGCCACCGGGCTCAGCGTCTACGGCAAAGT
GAGCCAGGCGCAGGCGGGTTCCATGGCCAAGGCGGCTCTCGAGTCTTCGACCATGGAGCAGCCCGCGACGGGAGG
GCCACAGAGCGCGGAAGATGCCGTGTCGGCGAGGCGGCGTGCCATGAAGGAGACGGTTCTCGACGGCTTCGACAA
GACAGCGGCCAAGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail