Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3616
Gene name
LocationContig_321:16415..18091
Strand-
Gene length (bp)1676
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 1.5E-07 343 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SKC1|U74C1_ARATH UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana GN=UGT74C1 PE=2 SV=1 294 510 2.0E-10
sp|Q5XF20|U84A1_ARATH UDP-glycosyltransferase 84A1 OS=Arabidopsis thaliana GN=UGT84A1 PE=1 SV=1 262 505 2.0E-10
sp|O22182|U84B1_ARATH UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana GN=UGT84B1 PE=2 SV=1 303 483 6.0E-10
sp|O22822|U74F2_ARATH UDP-glycosyltransferase 74F2 OS=Arabidopsis thaliana GN=UGT74F2 PE=1 SV=1 302 500 1.0E-09
sp|Q2V6K1|UGT_FRAAN Putative UDP-glucose glucosyltransferase OS=Fragaria ananassa GN=GT5 PE=2 SV=1 302 505 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SKC1|U74C1_ARATH UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana GN=UGT74C1 PE=2 SV=1 294 510 2.0E-10
sp|Q5XF20|U84A1_ARATH UDP-glycosyltransferase 84A1 OS=Arabidopsis thaliana GN=UGT84A1 PE=1 SV=1 262 505 2.0E-10
sp|O22182|U84B1_ARATH UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana GN=UGT84B1 PE=2 SV=1 303 483 6.0E-10
sp|O22822|U74F2_ARATH UDP-glycosyltransferase 74F2 OS=Arabidopsis thaliana GN=UGT74F2 PE=1 SV=1 302 500 1.0E-09
sp|Q2V6K1|UGT_FRAAN Putative UDP-glucose glucosyltransferase OS=Fragaria ananassa GN=GT5 PE=2 SV=1 302 505 6.0E-09
sp|Q9LVF0|U84A2_ARATH UDP-glycosyltransferase 84A2 OS=Arabidopsis thaliana GN=UGT84A2 PE=1 SV=1 262 505 8.0E-09
sp|O22183|U84B2_ARATH UDP-glycosyltransferase 84B2 OS=Arabidopsis thaliana GN=UGT84B2 PE=3 SV=1 262 483 9.0E-09
sp|O23402|U84A4_ARATH UDP-glycosyltransferase 84A4 OS=Arabidopsis thaliana GN=UGT84A4 PE=2 SV=1 262 510 3.0E-08
sp|O22820|U74F1_ARATH UDP-glycosyltransferase 74F1 OS=Arabidopsis thaliana GN=UGT74F1 PE=1 SV=1 302 500 4.0E-08
sp|Q9FI99|U76C1_ARATH UDP-glycosyltransferase 76C1 OS=Arabidopsis thaliana GN=UGT76C1 PE=1 SV=1 230 485 7.0E-08
sp|Q9MB73|LGT_CITUN Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1 258 505 9.0E-08
sp|O23401|U84A3_ARATH UDP-glycosyltransferase 84A3 OS=Arabidopsis thaliana GN=UGT84A3 PE=1 SV=1 280 505 1.0E-07
sp|D3UAG3|U88F2_PYRCO Phloretin 2'-O-glucosyltransferase OS=Pyrus communis GN=UGT88F2 PE=1 SV=1 257 508 1.0E-07
sp|D3UAG6|U88F5_MALDO UDP-glycosyltransferase 88F5 OS=Malus domestica GN=UGT88F5 PE=2 SV=1 257 489 2.0E-07
sp|B3TKC8|88F1G_MALDO Phloretin 2'-O-glucosyltransferase OS=Malus domestica GN=UGT88F1 PE=1 SV=1 257 508 2.0E-07
sp|D3UAG5|88F1R_MALDO Phloretin 2'-O-glucosyltransferase OS=Malus domestica GN=UGT88F1 PE=2 SV=1 257 508 2.0E-07
sp|Q8GVE3|FLRT_CITMA Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase OS=Citrus maxima GN=C12RT1 PE=1 SV=2 280 493 4.0E-07
sp|Q9ZU72|U72D1_ARATH UDP-glycosyltransferase 72D1 OS=Arabidopsis thaliana GN=UGT72D1 PE=2 SV=1 269 483 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3616
MDKTPLSPQETKSCPPQKILFLTNSELGEANVFLALFTALAKANPHVQVHLASFASLRIHADEVSRQVLEKLPRA
RPLIFHEIRGLPIIDAYSDVYCFGSEAISTPLRFGTTLRSLNALVSVFLPYDGPQLVEVVSSLADIIREVEPDLV
VVNSVMSAGLTVCYHLRVKFMCLSPNSISLFAKRSQPRLEAMWKHPAPFSGYSYPVPYHLIPLNVYYLLHVTYVW
RTSRRRKEATAYLAAHTGAVFRTVLDLLVARPPGCKILISSLPELDRPLIIPPFLYPCGPIVRHARTVAEADPEL
GNWLAQGPTIYVNLGSLLWFDSYRTTELAKALRIVMERLGKGGKIGLQVLWKLKPGKDSKDDDLFGLAHDILDSR
NRDGRVRIVDWIEAEPLSILKSGRVICSVNHGGASSFNEAVVAGIPQVILPVWTDCHDNAHLVEALGIGRHGSKK
TKPRWTAAELSTELLHVLEGEAAEKIRQEAEKLADLCASRGDGADTAAKILMDELPSLRT*
Coding >Ophun1|3616
ATGGATAAAACCCCCCTCTCACCCCAAGAAACCAAATCATGCCCCCCCCAAAAGATCCTCTTCCTCACAAACTCA
GAGCTCGGCGAAGCAAACGTCTTCCTCGCCCTCTTCACCGCCCTAGCCAAAGCCAACCCCCATGTCCAAGTCCAT
CTTGCCAGCTTCGCCAGCCTGAGGATCCACGCGGACGAGGTGTCGAGACAGGTGCTGGAGAAGCTGCCGCGGGCC
AGACCGCTCATCTTCCATGAGATTCGCGGCCTGCCCATCATCGATGCCTATTCGGACGTTTACTGCTTTGGTAGC
GAGGCTATTAGCACGCCGCTGCGGTTTGGCACTACGCTTCGGTCTTTGAATGCTTTGGTTTCTGTCTTTTTGCCC
TACGATGGGCCGCAGCTTGTTGAGGTGGTGTCGTCACTTGCGGATATAATACGCGAGGTTGAGCCTGATCTCGTC
GTTGTCAACAGCGTCATGTCGGCTGGACTGACCGTCTGCTACCATCTTCGAGTCAAGTTCATGTGTCTCAGCCCA
AACTCCATCAGCTTGTTCGCTAAACGGAGTCAGCCGCGGCTCGAGGCCATGTGGAAGCATCCTGCGCCTTTTTCT
GGATACTCGTATCCCGTTCCCTATCACCTTATTCCTCTCAACGTCTACTATCTCCTTCACGTCACCTACGTCTGG
CGGACGAGCCGTCGCCGCAAAGAAGCAACAGCTTACCTCGCCGCTCACACGGGAGCCGTCTTCCGCACAGTCCTC
GACCTCCTGGTAGCCAGACCACCAGGCTGCAAGATCCTGATCAGCAGCCTCCCAGAGTTGGACCGCCCTCTGATA
ATCCCGCCCTTTCTCTATCCTTGCGGGCCCATTGTGCGGCACGCCAGGACTGTGGCCGAGGCAGACCCAGAGTTG
GGGAATTGGCTCGCCCAGGGGCCGACCATCTACGTCAATCTCGGTTCCTTGTTGTGGTTTGATAGTTATCGGACG
ACTGAGCTGGCGAAGGCGTTGAGGATTGTCATGGAGAGACTGGGAAAAGGGGGTAAGATTGGGCTTCAAGTGCTG
TGGAAGCTCAAGCCTGGCAAGGATTCCAAGGACGACGATCTCTTCGGGCTCGCGCATGATATCCTCGACAGCCGG
AATAGAGATGGAAGGGTCAGGATCGTCGACTGGATAGAGGCAGAGCCGCTGTCCATCCTGAAGAGCGGACGCGTC
ATCTGCTCAGTCAACCACGGCGGCGCAAGCTCCTTCAACGAAGCCGTCGTTGCTGGCATCCCTCAAGTCATCCTG
CCCGTCTGGACCGACTGCCACGACAATGCTCATCTCGTCGAAGCGCTCGGCATCGGTCGCCACGGCAGCAAGAAG
ACGAAGCCACGATGGACTGCGGCCGAGCTCTCGACTGAGTTGCTTCATGTCTTGGAGGGCGAGGCGGCTGAGAAG
ATACGACAAGAGGCCGAGAAGCTGGCGGATCTCTGTGCGAGTCGCGGTGACGGTGCTGATACAGCAGCGAAGATT
CTCATGGATGAGCTGCCGAGCCTTCGAACATGA
Transcript >Ophun1|3616
ATGGATAAAACCCCCCTCTCACCCCAAGAAACCAAATCATGCCCCCCCCAAAAGATCCTCTTCCTCACAAACTCA
GAGCTCGGCGAAGCAAACGTCTTCCTCGCCCTCTTCACCGCCCTAGCCAAAGCCAACCCCCATGTCCAAGTCCAT
CTTGCCAGCTTCGCCAGCCTGAGGATCCACGCGGACGAGGTGTCGAGACAGGTGCTGGAGAAGCTGCCGCGGGCC
AGACCGCTCATCTTCCATGAGATTCGCGGCCTGCCCATCATCGATGCCTATTCGGACGTTTACTGCTTTGGTAGC
GAGGCTATTAGCACGCCGCTGCGGTTTGGCACTACGCTTCGGTCTTTGAATGCTTTGGTTTCTGTCTTTTTGCCC
TACGATGGGCCGCAGCTTGTTGAGGTGGTGTCGTCACTTGCGGATATAATACGCGAGGTTGAGCCTGATCTCGTC
GTTGTCAACAGCGTCATGTCGGCTGGACTGACCGTCTGCTACCATCTTCGAGTCAAGTTCATGTGTCTCAGCCCA
AACTCCATCAGCTTGTTCGCTAAACGGAGTCAGCCGCGGCTCGAGGCCATGTGGAAGCATCCTGCGCCTTTTTCT
GGATACTCGTATCCCGTTCCCTATCACCTTATTCCTCTCAACGTCTACTATCTCCTTCACGTCACCTACGTCTGG
CGGACGAGCCGTCGCCGCAAAGAAGCAACAGCTTACCTCGCCGCTCACACGGGAGCCGTCTTCCGCACAGTCCTC
GACCTCCTGGTAGCCAGACCACCAGGCTGCAAGATCCTGATCAGCAGCCTCCCAGAGTTGGACCGCCCTCTGATA
ATCCCGCCCTTTCTCTATCCTTGCGGGCCCATTGTGCGGCACGCCAGGACTGTGGCCGAGGCAGACCCAGAGTTG
GGGAATTGGCTCGCCCAGGGGCCGACCATCTACGTCAATCTCGGTTCCTTGTTGTGGTTTGATAGTTATCGGACG
ACTGAGCTGGCGAAGGCGTTGAGGATTGTCATGGAGAGACTGGGAAAAGGGGGTAAGATTGGGCTTCAAGTGCTG
TGGAAGCTCAAGCCTGGCAAGGATTCCAAGGACGACGATCTCTTCGGGCTCGCGCATGATATCCTCGACAGCCGG
AATAGAGATGGAAGGGTCAGGATCGTCGACTGGATAGAGGCAGAGCCGCTGTCCATCCTGAAGAGCGGACGCGTC
ATCTGCTCAGTCAACCACGGCGGCGCAAGCTCCTTCAACGAAGCCGTCGTTGCTGGCATCCCTCAAGTCATCCTG
CCCGTCTGGACCGACTGCCACGACAATGCTCATCTCGTCGAAGCGCTCGGCATCGGTCGCCACGGCAGCAAGAAG
ACGAAGCCACGATGGACTGCGGCCGAGCTCTCGACTGAGTTGCTTCATGTCTTGGAGGGCGAGGCGGCTGAGAAG
ATACGACAAGAGGCCGAGAAGCTGGCGGATCTCTGTGCGAGTCGCGGTGACGGTGCTGATACAGCAGCGAAGATT
CTCATGGATGAGCTGCCGAGCCTTCGAACATGA
Gene >Ophun1|3616
ATGGATAAAACCCCCCTCTCACCCCAAGAAACCAAATCATGCCCCCCCCAAAAGATCCTCTTCCTCACAAACTCA
GAGCTCGGCGAAGCAAACGTCTTCCTCGCCCTCTTCACCGCCCTAGCCAAAGCCAACCCCCATGTCCAAGTCCAT
CTTGCCAGCTTCGCCAGCCTGAGGATCCACGCGGACGAGGTGTCGAGACAGGTGCTGGAGAAGCTGCCGCGGGCC
AGACCGCTCATCTTCCATGAGATTCGCGGCCTGCCCATCATCGATGCCTATTCGGACGTTTACTGCTTTGGTAGC
GAGGCTATTAGCACGCCGCTGCGGTTTGGCACTACGCTTCGGTCTTTGAATGCTTTGGTTTCTGTCTTTTTGCCC
TACGATGGGCCGCAGCTTGTTGAGGTGGTGTCGTCACTTGCGGATATAATACGCGAGGTTGAGCCTGATCTCGTC
GTTGTCAACAGCGTCATGTCGGCTGGACTGACCGTCTGCTACCATCTTCGAGTCAAGTTCATGTGTCTCAGCCCA
AACTCCATCAGCTTGTTCGCTAAACGGAGTCAGCCGCGGCTCGAGGCCATGTGGAAGCATCCTGCGTGAGTAATA
GGCAATCCCCTGCGTCTACGTCTGGAAGATTGACGGCATTCGTGATGCTTGTTACAAGGCCTTTTTCTGGATACT
CGTATCCCGTTCCCTATCACCTTATTCCTCTCAACGTCTACTATCTCCTTCACGTCACCTACGTCTGGCGGACGA
GCCGTCGCCGCAAAGAAGCAACAGCTTACCTCGCCGCTCACACGGGAGCCGTCTTCCGCACAGTCCTCGACCTCC
TGGTAGCCAGACCACCAGGCTGCAAGATCCTGATCAGCAGCCTCCCAGAGTTGGACCGCCCTCTGATAATCCCGC
CCTTTCTCTATCCTTGCGGGCCCATTGTGCGGCACGCCAGGACTGTGGCCGAGGCAGACCCAGAGTTGGGGAATT
GGCTCGCCCAGGGGCCGACCATCTACGTCAATCTCGGTTCCTTGTTGTGGTTTGATAGTTATCGGACGACTGAGC
TGGCGAAGGCGTTGAGGATTGTCATGGAGAGACTGGGAAAAGGGGGTAAGATTGGGCTTCAAGTGCTGTGGAAGC
TCAAGCCTGGCAAGGATTCCAAGGACGACGATCTCTTCGGGCTCGCGCATGATATCCTCGACAGCCGGAATAGAG
ATGGAAGGGTCAGGATCGTCGACTGGATAGAGGCAGAGCCGCTGTCCATCCTGAAGAGCGGACGCGTCATCTGCT
CAGTCAACCACGGCGGCGCAAGCTCCTTCAACGAAGCCGTCGTGTAAGTCGACCAAGTCCTCATCCCTTTATCTG
AAGAAGAACAGCACTCCAGCTAATACCACGGTTGATCACTCAGTGCTGGCATCCCTCAAGTCATCCTGCCCGTCT
GGACCGACTGCCACGACAATGCTCATCTCGTCGAAGCGCTCGGCATCGGTCGCCACGGCAGCAAGAAGACGAAGC
CACGATGGACTGCGGCCGAGCTCTCGACTGAGTTGCTTCATGTCTTGGAGGGCGAGGCGGCTGAGAAGATACGAC
AAGAGGCCGAGAAGCTGGCGGATCTCTGTGCGAGTCGCGGTGACGGTGCTGATACAGCAGCGAAGATTCTCATGG
ATGAGCTGCCGAGCCTTCGAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail