Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3614
Gene name
LocationContig_321:10906..12993
Strand-
Gene length (bp)2087
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03851 UvdE UV-endonuclease UvdE 4.9E-109 237 542

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01408|UVE1_NEUCR UV-damage endonuclease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-18 PE=2 SV=2 143 649 0.0E+00
sp|Q10988|UVE1_SCHPO UV-damage endonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uve1 PE=2 SV=1 230 568 2.0E-120
sp|Q5UNU2|UVE1H_MIMIV Putative UV-damage endonuclease OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L687 PE=1 SV=1 236 562 3.0E-46
sp|A8FIG1|UVSE_BACP2 UV DNA damage endonuclease OS=Bacillus pumilus (strain SAFR-032) GN=uvsE PE=3 SV=1 306 563 9.0E-37
sp|Q8XIP3|UVSE_CLOPE UV DNA damage endonuclease OS=Clostridium perfringens (strain 13 / Type A) GN=uvsE PE=3 SV=1 302 567 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01408|UVE1_NEUCR UV-damage endonuclease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-18 PE=2 SV=2 143 649 0.0E+00
sp|Q10988|UVE1_SCHPO UV-damage endonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uve1 PE=2 SV=1 230 568 2.0E-120
sp|Q5UNU2|UVE1H_MIMIV Putative UV-damage endonuclease OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L687 PE=1 SV=1 236 562 3.0E-46
sp|A8FIG1|UVSE_BACP2 UV DNA damage endonuclease OS=Bacillus pumilus (strain SAFR-032) GN=uvsE PE=3 SV=1 306 563 9.0E-37
sp|Q8XIP3|UVSE_CLOPE UV DNA damage endonuclease OS=Clostridium perfringens (strain 13 / Type A) GN=uvsE PE=3 SV=1 302 567 4.0E-35
sp|A7Z9T8|UVSE_BACMF UV DNA damage endonuclease OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=uvsE PE=3 SV=1 288 563 3.0E-33
sp|B7IR00|UVSE_BACC2 UV DNA damage endonuclease OS=Bacillus cereus (strain G9842) GN=uvsE PE=3 SV=1 307 563 4.0E-29
sp|A9VSE5|UVSE_BACWK UV DNA damage endonuclease OS=Bacillus weihenstephanensis (strain KBAB4) GN=uvsE PE=3 SV=1 265 563 8.0E-29
sp|Q9L4F0|UVSE_BACCR UV DNA damage endonuclease OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=uvsE PE=3 SV=1 307 563 1.0E-28
sp|B7HFP5|UVSE_BACC4 UV DNA damage endonuclease OS=Bacillus cereus (strain B4264) GN=uvsE PE=3 SV=1 307 563 1.0E-28
sp|P45864|UVSE_BACSU UV DNA damage endonuclease OS=Bacillus subtilis (strain 168) GN=uvsE PE=3 SV=1 271 563 2.0E-28
sp|B9IRY0|UVSE_BACCQ UV DNA damage endonuclease OS=Bacillus cereus (strain Q1) GN=uvsE PE=3 SV=1 307 563 2.0E-26
sp|Q72XA0|UVSE_BACC1 UV DNA damage endonuclease OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=uvsE PE=3 SV=1 307 564 3.0E-26
sp|C3LFM1|UVSE_BACAC UV DNA damage endonuclease OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=uvsE PE=3 SV=1 307 564 5.0E-26
sp|Q6HAT6|UVSE_BACHK UV DNA damage endonuclease OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=uvsE PE=3 SV=1 313 564 5.0E-26
sp|C1F0S5|UVSE_BACC3 UV DNA damage endonuclease OS=Bacillus cereus (strain 03BB102) GN=uvsE PE=3 SV=1 307 564 6.0E-26
sp|Q81JV2|UVSE_BACAN UV DNA damage endonuclease OS=Bacillus anthracis GN=uvsE PE=3 SV=2 307 564 2.0E-25
sp|C3P2A9|UVSE_BACAA UV DNA damage endonuclease OS=Bacillus anthracis (strain A0248) GN=uvsE PE=3 SV=1 307 564 2.0E-25
sp|Q9K9P8|UVSE_BACHD UV DNA damage endonuclease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=uvsE PE=3 SV=1 272 564 3.0E-24
sp|Q8YXF0|UVSE_NOSS1 UV DNA damage endonuclease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=uvsE PE=3 SV=1 281 570 2.0E-18
sp|Q9RTE6|UVSE_DEIRA UV DNA damage endonuclease OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=uvsE PE=1 SV=2 321 567 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0004519 endonuclease activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0009411 response to UV Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009416 response to light stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044238 primary metabolic process No
GO:0009628 response to abiotic stimulus No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006281 DNA repair No
GO:0033554 cellular response to stress No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0004518 nuclease activity No
GO:0009314 response to radiation No
GO:0006950 response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3614
MKLSMKLADEAPDDDATNRWFAVEAGAQIAIRRHGPWTCWSLFLSPSHYRSRARHNRAHHSRAHHSRPSAPDRAA
HRRRMPLKSLALPLRRLLSTSSSGTNIAMPPKRKRSAAQPEAPARRSTRTSKVAAALPDPTDDVLSSKEAVAKAV
HGLSEMEQRLHREVRKQRLAVQNSDLCRDKPKTTRKPPVEAQTNGGSADTNGADAEAQTEHVAPEKGARRPPAVN
SDRLPLPWSGRLGYACLNTYLRAATPPVFCSRTCRLSSIIDHRHPLADPSQPEHATKNRPDKTKPAEVERGLAFV
QSLGVANAADIPKMLRWNDRYGIKFMRLSSEMFPFASHKEHGYKLAPFASDVLAEAGRVAAELGHRLTTHPGQYT
QIGSPRPEVVTAAVRDLEYHNELLSLLKLPEQQDRDAVMILHMGGMFGDKGATLDRFRQEYARLSDGVKRRLVLE
NDDVVWNVHDLLPICEELNIPLVLDFHHHNIVFDPVMREGTQDIIGLFDRIKATWTRKGIRQKMHYSESTAAAVT
SRDRRKHSARVKTLPPCASDMDLMIEAKDKEQAVFELMRTFKLPGWDLFNDVVPYERDDEPRKAVVKKIKKGKKA
SGEDQVEVIVPEREVGPESVSMGGTEKRVYWPEGMEEWLRPKKRQVNKANGKAGADEGTNGDEEAIKEEEEEREG
*
Coding >Ophun1|3614
ATGAAGCTCTCGATGAAGCTGGCCGATGAAGCTCCCGATGATGACGCAACCAACCGATGGTTTGCGGTCGAGGCT
GGGGCGCAGATCGCGATACGTCGACATGGCCCTTGGACCTGTTGGTCTCTCTTCCTCTCCCCCTCTCATTACCGC
AGCAGGGCACGCCACAACAGGGCACACCACAGCAGGGCACACCACAGCAGGCCATCGGCACCGGACCGCGCCGCC
CATCGCCGTCGCATGCCGCTCAAGAGCTTGGCGCTGCCCTTGCGGAGACTCCTGTCGACCTCATCTTCGGGTACG
AACATTGCCATGCCACCCAAGCGCAAGCGGTCGGCCGCCCAGCCCGAAGCTCCGGCCAGACGCAGTACCCGGACC
TCGAAAGTTGCCGCCGCTCTGCCCGACCCGACCGACGATGTGCTCAGTTCCAAGGAGGCCGTCGCGAAGGCCGTT
CATGGACTGAGCGAGATGGAGCAGCGTCTGCACCGCGAGGTCAGAAAGCAGCGTCTTGCCGTTCAAAACTCCGAC
TTGTGCCGTGACAAGCCTAAAACGACTCGCAAACCACCTGTTGAGGCTCAGACCAATGGGGGGAGTGCCGATACT
AATGGGGCAGATGCCGAGGCTCAGACGGAACATGTCGCTCCGGAAAAGGGAGCCCGGAGACCGCCGGCTGTCAAC
AGCGACAGGCTGCCTTTGCCCTGGTCTGGCAGGTTAGGTTATGCTTGTCTCAACACGTATCTTCGAGCAGCAACG
CCGCCCGTCTTTTGCTCGCGGACGTGTCGATTGAGCTCCATCATTGACCACCGCCACCCCCTGGCGGACCCTTCA
CAGCCGGAGCATGCCACCAAGAATCGACCTGACAAGACGAAGCCGGCCGAAGTTGAGAGAGGGCTCGCTTTCGTC
CAGAGCCTGGGTGTCGCCAACGCAGCTGACATTCCCAAGATGCTTCGTTGGAACGATAGGTATGGCATCAAGTTT
ATGCGGCTGAGCAGTGAAATGTTCCCCTTTGCGAGCCACAAAGAGCACGGCTACAAGCTGGCGCCCTTTGCGTCC
GACGTCTTGGCCGAGGCTGGCAGAGTCGCCGCCGAGCTGGGCCATCGTCTGACGACTCACCCGGGACAGTACACG
CAGATCGGCAGTCCGCGGCCGGAGGTGGTTACGGCTGCGGTCCGAGACTTGGAGTATCACAACGAGCTGCTTTCC
CTCCTGAAGCTCCCGGAGCAGCAGGACCGCGACGCCGTCATGATTCTGCACATGGGCGGCATGTTTGGCGACAAG
GGCGCCACGCTCGATCGATTCCGTCAAGAATACGCCCGGTTATCAGACGGGGTGAAGCGCAGACTGGTACTAGAG
AACGACGATGTCGTATGGAACGTTCATGACTTACTCCCTATCTGCGAGGAACTCAACATTCCGCTCGTGCTCGAC
TTTCATCACCATAACATCGTCTTCGATCCTGTTATGCGCGAGGGCACGCAGGACATCATAGGCTTGTTCGACCGC
ATCAAGGCTACGTGGACGAGAAAAGGCATCAGGCAGAAGATGCACTACAGCGAGTCTACAGCCGCAGCCGTCACG
TCGCGCGACCGCAGGAAGCACTCAGCTCGCGTCAAGACGCTACCACCTTGCGCCTCGGACATGGACCTCATGATT
GAGGCCAAAGATAAGGAGCAGGCCGTCTTTGAGCTGATGCGGACTTTCAAACTCCCCGGCTGGGACCTCTTCAAC
GATGTAGTGCCGTACGAGCGCGATGATGAACCTCGCAAGGCGGTCGTCAAGAAGATCAAGAAGGGAAAAAAGGCC
AGTGGCGAGGATCAGGTCGAGGTCATTGTGCCGGAAAGGGAGGTCGGTCCGGAGAGCGTCAGCATGGGCGGCACG
GAGAAGCGCGTCTACTGGCCCGAGGGGATGGAGGAGTGGTTAAGGCCGAAGAAGCGGCAGGTGAACAAGGCCAAC
GGCAAGGCGGGCGCGGACGAGGGTACGAATGGCGATGAGGAGGCTATCAAGGAGGAAGAGGAGGAACGGGAGGGT
TAG
Transcript >Ophun1|3614
ATGAAGCTCTCGATGAAGCTGGCCGATGAAGCTCCCGATGATGACGCAACCAACCGATGGTTTGCGGTCGAGGCT
GGGGCGCAGATCGCGATACGTCGACATGGCCCTTGGACCTGTTGGTCTCTCTTCCTCTCCCCCTCTCATTACCGC
AGCAGGGCACGCCACAACAGGGCACACCACAGCAGGGCACACCACAGCAGGCCATCGGCACCGGACCGCGCCGCC
CATCGCCGTCGCATGCCGCTCAAGAGCTTGGCGCTGCCCTTGCGGAGACTCCTGTCGACCTCATCTTCGGGTACG
AACATTGCCATGCCACCCAAGCGCAAGCGGTCGGCCGCCCAGCCCGAAGCTCCGGCCAGACGCAGTACCCGGACC
TCGAAAGTTGCCGCCGCTCTGCCCGACCCGACCGACGATGTGCTCAGTTCCAAGGAGGCCGTCGCGAAGGCCGTT
CATGGACTGAGCGAGATGGAGCAGCGTCTGCACCGCGAGGTCAGAAAGCAGCGTCTTGCCGTTCAAAACTCCGAC
TTGTGCCGTGACAAGCCTAAAACGACTCGCAAACCACCTGTTGAGGCTCAGACCAATGGGGGGAGTGCCGATACT
AATGGGGCAGATGCCGAGGCTCAGACGGAACATGTCGCTCCGGAAAAGGGAGCCCGGAGACCGCCGGCTGTCAAC
AGCGACAGGCTGCCTTTGCCCTGGTCTGGCAGGTTAGGTTATGCTTGTCTCAACACGTATCTTCGAGCAGCAACG
CCGCCCGTCTTTTGCTCGCGGACGTGTCGATTGAGCTCCATCATTGACCACCGCCACCCCCTGGCGGACCCTTCA
CAGCCGGAGCATGCCACCAAGAATCGACCTGACAAGACGAAGCCGGCCGAAGTTGAGAGAGGGCTCGCTTTCGTC
CAGAGCCTGGGTGTCGCCAACGCAGCTGACATTCCCAAGATGCTTCGTTGGAACGATAGGTATGGCATCAAGTTT
ATGCGGCTGAGCAGTGAAATGTTCCCCTTTGCGAGCCACAAAGAGCACGGCTACAAGCTGGCGCCCTTTGCGTCC
GACGTCTTGGCCGAGGCTGGCAGAGTCGCCGCCGAGCTGGGCCATCGTCTGACGACTCACCCGGGACAGTACACG
CAGATCGGCAGTCCGCGGCCGGAGGTGGTTACGGCTGCGGTCCGAGACTTGGAGTATCACAACGAGCTGCTTTCC
CTCCTGAAGCTCCCGGAGCAGCAGGACCGCGACGCCGTCATGATTCTGCACATGGGCGGCATGTTTGGCGACAAG
GGCGCCACGCTCGATCGATTCCGTCAAGAATACGCCCGGTTATCAGACGGGGTGAAGCGCAGACTGGTACTAGAG
AACGACGATGTCGTATGGAACGTTCATGACTTACTCCCTATCTGCGAGGAACTCAACATTCCGCTCGTGCTCGAC
TTTCATCACCATAACATCGTCTTCGATCCTGTTATGCGCGAGGGCACGCAGGACATCATAGGCTTGTTCGACCGC
ATCAAGGCTACGTGGACGAGAAAAGGCATCAGGCAGAAGATGCACTACAGCGAGTCTACAGCCGCAGCCGTCACG
TCGCGCGACCGCAGGAAGCACTCAGCTCGCGTCAAGACGCTACCACCTTGCGCCTCGGACATGGACCTCATGATT
GAGGCCAAAGATAAGGAGCAGGCCGTCTTTGAGCTGATGCGGACTTTCAAACTCCCCGGCTGGGACCTCTTCAAC
GATGTAGTGCCGTACGAGCGCGATGATGAACCTCGCAAGGCGGTCGTCAAGAAGATCAAGAAGGGAAAAAAGGCC
AGTGGCGAGGATCAGGTCGAGGTCATTGTGCCGGAAAGGGAGGTCGGTCCGGAGAGCGTCAGCATGGGCGGCACG
GAGAAGCGCGTCTACTGGCCCGAGGGGATGGAGGAGTGGTTAAGGCCGAAGAAGCGGCAGGTGAACAAGGCCAAC
GGCAAGGCGGGCGCGGACGAGGGTACGAATGGCGATGAGGAGGCTATCAAGGAGGAAGAGGAGGAACGGGAGGGT
TAG
Gene >Ophun1|3614
ATGAAGCTCTCGATGAAGCTGGCCGATGAAGCTCCCGATGATGACGCAACCAACCGATGGTTTGCGGTCGAGGCT
GGGGCGCAGATCGCGATACGTCGACATGGCCCTTGGACCTGTTGGTCTCTCTTCCTCTCCCCCTCTCATTACCGC
AGCAGGGCACGCCACAACAGGGCACACCACAGCAGGGCACACCACAGCAGGCCATCGGCACCGGACCGCGCCGCC
CATCGCCGTCGCATGCCGCTCAAGAGCTTGGCGCTGCCCTTGCGGAGACTCCTGTCGACCTCATCTTCGGGTACG
AACATTGCCATGCCACCCAAGCGCAAGCGGTCGGCCGCCCAGCCCGAAGCTCCGGCCAGACGCAGTACCCGGACC
TCGAAAGTTGCCGCCGCTCTGCCCGACCCGACCGACGATGTGCTCAGTTCCAAGGAGGCCGTCGCGAAGGCCGTT
CATGGACTGAGCGAGATGGAGCAGCGTCTGCACCGCGAGGTCAGAAAGCAGCGTCTTGCCGTTCAAAACTCCGAC
TTGTGCCGTGACAAGCCTAAAACGACTCGCAAACCACCTGTTGAGGCTCAGACCAATGGGGGGAGTGCCGATACT
AATGGGGCAGATGCCGAGGCTCAGACGGAACATGTCGCTCCGGAAAAGGGAGCCCGGAGACCGCCGGCTGTCAAC
AGCGACAGGCTGCCTTTGCCCTGGTCTGGCAGGTTAGGTTATGTGAGGATGCCCGGACGGTCACGCTCGCAAGAC
GGGCAGATGCTGACGGTAGCCTCCAGGCTTGTCTCAACACGTATCTTCGAGCAGCAACGCCGCCCGTCTTTTGCT
CGCGGACGTGTCGATTGAGCTCCATCATTGACCACCGCCACCCCCTGGCGGACCCTTCACAGCCGGAGCATGCCA
CCAAGAATCGACCTGACAAGACGAAGCCGGCCGAAGTTGAGAGAGGGCTCGCTTTCGTCCAGAGCCTGGGTGTCG
CCAACGCAGCTGACATTCCCAAGATGCTTCGTTGGAACGATAGGTATGGCATCAAGTTTATGCGGCTGAGCAGTG
AAATGTTCCCCTTTGCGAGCCACAAAGAGCACGGCTACAAGCTGGCGCCCTTTGCGTCCGACGTCTTGGCCGAGG
CTGGCAGAGTCGCCGCCGAGCTGGGCCATCGTCTGACGACTCACCCGGGACAGTACACGCAGATCGGCAGTCCGC
GGCCGGAGGTGGTTACGGCTGCGGTCCGAGACTTGGAGTATCACAACGAGCTGCTTTCCCTCCTGAAGCTCCCGG
AGCAGCAGGACCGCGACGCCGTCATGATTCTGCACATGGGCGGCATGTTTGGCGACAAGGGCGCCACGCTCGATC
GATTCCGTCAAGAATACGCCCGGTTATCAGACGGGGTGAAGCGCAGACTGGTACTAGAGAACGACGATGTCGTAT
GGAACGTTCATGACTTACTCCCTATCTGCGAGGAACTCAACATTCCGCTCGTGCTCGACTTTCATCACCATAACA
TCGTCTTCGATCCTGTTATGCGCGAGGGCACGCAGGACATCATAGGCTTGTTCGACCGCATCAAGGCTACGTGGA
CGAGAAAAGGCATCAGGCAGAAGATGCACTACAGCGAGTCTACAGCCGCAGCCGTCACGTCGCGCGACCGCAGGA
AGCACTCAGCTCGCGTCAAGACGCTACCACCTTGCGCCTCGGACATGGACCTCATGATTGAGGCCAAAGATAAGG
AGCAGGCCGTCTTTGAGCTGATGCGGACTTTCAAACTCCCCGGCTGGGACCTCTTCAACGATGTAGTGCCGTACG
AGCGCGATGATGAACCTCGCAAGGCGGTCGTCAAGAAGATCAAGAAGGGAAAAAAGGCCAGTGGCGAGGATCAGG
TCGAGGTCATTGTGCCGGAAAGGGAGGTCGGTCCGGAGAGCGTCAGCATGGGCGGCACGGAGAAGCGCGTCTACT
GGCCCGAGGGGATGGAGGAGTGGTTAAGGCCGAAGAAGCGGCAGGTGAACAAGGCCAACGGCAAGGCGGGCGCGG
ACGAGGGTACGAATGGCGATGAGGAGGCTATCAAGGAGGAAGAGGAGGAACGGGAGGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail