Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3613
Gene name
LocationContig_321:7999..9820
Strand-
Gene length (bp)1821
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999678

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3817
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1896
Ophiocordyceps australis map64 (Brazil) OphauB2|2011
Ophiocordyceps camponoti-floridani Ophcf2|03553
Ophiocordyceps camponoti-rufipedis Ophun1|3613 (this protein)
Ophiocordyceps kimflemingae Ophio5|3284
Ophiocordyceps subramaniannii Hirsu2|7488

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3613
MYRLSIAASALLAMHGVLAQQSPVTDQYPAEHTEEFKGYEGQYVDACSPVGTIRYNSTFPPCLSSSRIESSCALP
WKEGVSDEQRQGDWQAERKCLCEGSFFDDAGDGCLKCKEAYHIDSKDNLGIWKGFWEKMRGSYCKEEKLAGNFST
YWSGAFAEVSGSFKYGDDLGAKPAPGSIPIESYYTNDKQGPGPLPGSAPAGPSNNSSVPSNSTEETGVAQLTPDC
RTMTGAIDTLPAGNSAKFSNSSSGAILVSVTVNYNRICIINRSNREIQAVPQSEPEVKPISDKVIPKKEAAKEAD
FDMTGCPCAQQAVPEDKEVVKSESSLNAWNKVSVICGFDQEGGKASQGCEGPECGGATKDGEESSSDSGDVYGSD
VMGTFGESEGSDSAEKTSKNTIFVVKITQESSDGEKEGTYGQPKCTTCGKPKTPEGPSTSETEGSHDQPKCPICG
GKPVVPEGPSTGETENAYGQEQPETSDESQPGQTYGQSEAPSSEQPPAPGSEKPKCEACQNAKGPYGSEPEGASS
EPKVPVPEEPTPDGTYGPTDGPSSEQPQAQCPGGASCGEADGTYGQPQCTDGSCEKPEIPSDSQKAPEQAEDEDE
EDVNYC*
Coding >Ophun1|3613
ATGTACAGACTCAGCATCGCAGCCAGCGCCCTGCTGGCCATGCACGGCGTCCTCGCCCAGCAATCCCCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGCTACGAGGGCCAGTACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCGAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGGAGC
TTCTTCGACGATGCGGGCGATGGGTGCCTCAAGTGCAAGGAGGCCTACCACATTGACAGCAAGGACAACCTCGGC
ATCTGGAAGGGCTTCTGGGAGAAGATGCGTGGCAGCTACTGCAAGGAAGAGAAGCTGGCCGGTAACTTCTCCACC
TACTGGTCCGGAGCCTTTGCCGAAGTCTCGGGCTCTTTCAAGTATGGCGATGACCTCGGCGCCAAGCCTGCCCCG
GGAAGCATCCCCATTGAATCCTACTACACAAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
GGCCCCAGCAACAACAGCTCCGTCCCGTCCAACTCCACGGAAGAGACGGGCGTCGCCCAGCTCACTCCCGACTGC
CGCACCATGACGGGCGCCATCGACACCCTCCCAGCCGGCAACAGCGCCAAGTTCTCCAACTCGAGCTCCGGCGCC
ATCCTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACCGCTCCAACCGTGAGATCCAGGCCGTC
CCCCAGTCTGAGCCCGAGGTCAAGCCCATCTCCGACAAGGTGATTCCCAAGAAGGAGGCTGCCAAGGAGGCAGAC
TTCGACATGACGGGCTGCCCTTGCGCCCAGCAGGCTGTTCCCGAGGATAAGGAGGTTGTCAAGTCGGAGTCTTCG
CTCAATGCCTGGAACAAGGTGTCTGTCATCTGCGGCTTCGACCAGGAGGGTGGGAAGGCTTCCCAGGGATGTGAG
GGTCCTGAGTGCGGCGGTGCCACCAAGGATGGCGAGGAGTCCTCGTCTGATTCCGGTGATGTCTACGGCTCCGAC
GTCATGGGAACCTTTGGCGAATCTGAGGGCTCCGACTCCGCTGAGAAGACTTCCAAGAATACCATCTTCGTCGTC
AAGATCACCCAGGAATCCTCCGACGGTGAGAAGGAGGGCACCTATGGCCAGCCCAAGTGCACCACCTGCGGAAAG
CCCAAGACCCCCGAGGGACCCTCTACCAGCGAGACGGAGGGCTCGCATGATCAGCCCAAGTGCCCTATCTGCGGT
GGAAAGCCCGTGGTCCCAGAGGGCCCCTCCACCGGCGAGACGGAGAACGCCTACGGCCAGGAGCAGCCCGAGACC
TCGGACGAGTCTCAGCCTGGTCAGACCTACGGACAGTCAGAGGCCCCCTCCAGCGAGCAGCCCCCGGCCCCGGGC
TCGGAAAAGCCCAAGTGCGAAGCCTGCCAAAACGCAAAGGGCCCGTACGGCTCCGAGCCCGAGGGCGCCTCCAGC
GAGCCCAAGGTCCCCGTCCCGGAGGAGCCGACGCCCGACGGCACCTACGGACCGACCGATGGCCCTTCCAGCGAG
CAGCCTCAGGCCCAGTGCCCCGGCGGAGCTTCTTGCGGAGAGGCTGACGGAACCTACGGCCAGCCGCAATGCACC
GACGGCTCTTGCGAGAAGCCTGAGATCCCGTCTGACAGCCAGAAGGCTCCGGAGCAGGCCGAGGATGAGGACGAG
GAGGATGTCAACTACTGCTAG
Transcript >Ophun1|3613
ATGTACAGACTCAGCATCGCAGCCAGCGCCCTGCTGGCCATGCACGGCGTCCTCGCCCAGCAATCCCCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGCTACGAGGGCCAGTACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCGAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGGAGC
TTCTTCGACGATGCGGGCGATGGGTGCCTCAAGTGCAAGGAGGCCTACCACATTGACAGCAAGGACAACCTCGGC
ATCTGGAAGGGCTTCTGGGAGAAGATGCGTGGCAGCTACTGCAAGGAAGAGAAGCTGGCCGGTAACTTCTCCACC
TACTGGTCCGGAGCCTTTGCCGAAGTCTCGGGCTCTTTCAAGTATGGCGATGACCTCGGCGCCAAGCCTGCCCCG
GGAAGCATCCCCATTGAATCCTACTACACAAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
GGCCCCAGCAACAACAGCTCCGTCCCGTCCAACTCCACGGAAGAGACGGGCGTCGCCCAGCTCACTCCCGACTGC
CGCACCATGACGGGCGCCATCGACACCCTCCCAGCCGGCAACAGCGCCAAGTTCTCCAACTCGAGCTCCGGCGCC
ATCCTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACCGCTCCAACCGTGAGATCCAGGCCGTC
CCCCAGTCTGAGCCCGAGGTCAAGCCCATCTCCGACAAGGTGATTCCCAAGAAGGAGGCTGCCAAGGAGGCAGAC
TTCGACATGACGGGCTGCCCTTGCGCCCAGCAGGCTGTTCCCGAGGATAAGGAGGTTGTCAAGTCGGAGTCTTCG
CTCAATGCCTGGAACAAGGTGTCTGTCATCTGCGGCTTCGACCAGGAGGGTGGGAAGGCTTCCCAGGGATGTGAG
GGTCCTGAGTGCGGCGGTGCCACCAAGGATGGCGAGGAGTCCTCGTCTGATTCCGGTGATGTCTACGGCTCCGAC
GTCATGGGAACCTTTGGCGAATCTGAGGGCTCCGACTCCGCTGAGAAGACTTCCAAGAATACCATCTTCGTCGTC
AAGATCACCCAGGAATCCTCCGACGGTGAGAAGGAGGGCACCTATGGCCAGCCCAAGTGCACCACCTGCGGAAAG
CCCAAGACCCCCGAGGGACCCTCTACCAGCGAGACGGAGGGCTCGCATGATCAGCCCAAGTGCCCTATCTGCGGT
GGAAAGCCCGTGGTCCCAGAGGGCCCCTCCACCGGCGAGACGGAGAACGCCTACGGCCAGGAGCAGCCCGAGACC
TCGGACGAGTCTCAGCCTGGTCAGACCTACGGACAGTCAGAGGCCCCCTCCAGCGAGCAGCCCCCGGCCCCGGGC
TCGGAAAAGCCCAAGTGCGAAGCCTGCCAAAACGCAAAGGGCCCGTACGGCTCCGAGCCCGAGGGCGCCTCCAGC
GAGCCCAAGGTCCCCGTCCCGGAGGAGCCGACGCCCGACGGCACCTACGGACCGACCGATGGCCCTTCCAGCGAG
CAGCCTCAGGCCCAGTGCCCCGGCGGAGCTTCTTGCGGAGAGGCTGACGGAACCTACGGCCAGCCGCAATGCACC
GACGGCTCTTGCGAGAAGCCTGAGATCCCGTCTGACAGCCAGAAGGCTCCGGAGCAGGCCGAGGATGAGGACGAG
GAGGATGTCAACTACTGCTAG
Gene >Ophun1|3613
ATGTACAGACTCAGCATCGCAGCCAGCGCCCTGCTGGCCATGCACGGCGTCCTCGCCCAGCAATCCCCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGCTACGAGGGCCAGTACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCGAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGGAGC
TTCTTCGACGATGCGGGCGATGGGTGCCTCAAGTGCAAGGAGGCCTACCACATTGACAGCAAGGACAACCTCGGC
ATCTGGAAGGGCTTCTGGGAGAAGATGCGTGGCAGCTACTGCAAGGAAGAGAAGCTGGCCGGTAACTTCTCCACC
TACTGGTCCGGAGCCTTTGCCGAAGTCTCGGGCTCTTTCAAGTATGGCGATGACCTCGGCGCCAAGCCTGCCCCG
GGAAGCATCCCCATTGAATCCTACTACACAAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
GGCCCCAGCAACAACAGCTCCGTCCCGTCCAACTCCACGGAAGAGACGGGCGTCGCCCAGCTCACTCCCGACTGC
CGCACCATGACGGGCGCCATCGACACCCTCCCAGCCGGCAACAGCGCCAAGTTCTCCAACTCGAGCTCCGGCGCC
ATCCTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACCGCTCCAACCGTGAGATCCAGGCCGTC
CCCCAGTCTGAGCCCGAGGTCAAGCCCATCTCCGACAAGGTGATTCCCAAGAAGGAGGCTGCCAAGGAGGCAGAC
TTCGACATGACGGGCTGCCCTTGCGCCCAGCAGGCTGTTCCCGAGGATAAGGAGGTTGTCAAGTCGGAGTCTTCG
CTCAATGCCTGGAACAAGGTGTCTGTCATCTGCGGCTTCGACCAGGAGGGTGGGAAGGCTTCCCAGGGATGTGAG
GGTCCTGAGTGCGGCGGTGCCACCAAGGATGGCGAGGAGTCCTCGTCTGATTCCGGTGATGTCTACGGCTCCGAC
GTCATGGGAACCTTTGGCGAATCTGAGGGCTCCGACTCCGCTGAGAAGACTTCCAAGAATACCATCTTCGTCGTC
AAGATCACCCAGGAATCCTCCGACGGTGAGAAGGAGGGCACCTATGGCCAGCCCAAGTGCACCACCTGCGGAAAG
CCCAAGACCCCCGAGGGACCCTCTACCAGCGAGACGGAGGGCTCGCATGATCAGCCCAAGTGCCCTATCTGCGGT
GGAAAGCCCGTGGTCCCAGAGGGCCCCTCCACCGGCGAGACGGAGAACGCCTACGGCCAGGAGCAGCCCGAGACC
TCGGACGAGTCTCAGCCTGGTCAGACCTACGGACAGTCAGAGGCCCCCTCCAGCGAGCAGCCCCCGGCCCCGGGC
TCGGAAAAGCCCAAGTGCGAAGCCTGCCAAAACGCAAAGGGCCCGTACGGCTCCGAGCCCGAGGGCGCCTCCAGC
GAGCCCAAGGTCCCCGTCCCGGAGGAGCCGACGCCCGACGGCACCTACGGACCGACCGATGGCCCTTCCAGCGAG
CAGCCTCAGGCCCAGTGCCCCGGCGGAGCTTCTTGCGGAGAGGCTGACGGAACCTACGGCCAGCCGCAATGCACC
GACGGCTCTTGCGAGAAGCCTGAGATCCCGTCTGACAGCCAGAAGGCTCCGGAGCAGGCCGAGGATGAGGACGAG
GAGGATGTCAACTACTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail