Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3610
Gene name
LocationContig_321:897..2356
Strand-
Gene length (bp)1459
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08618 Opi1 Transcription factor Opi1 7.6E-29 229 384
PF08618 Opi1 Transcription factor Opi1 1.4E-07 400 439

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-8 PE=2 SV=3 50 437 5.0E-65

GO

GO Term Description Terminal node
GO:0003714 transcription corepressor activity Yes
GO:0140110 transcription regulator activity No
GO:0003712 transcription coregulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3610
MTISGPRDLDPKRHEPVNMTDSWNSSLAYRPPLTTVKGTPSVDAEIDRQLSLDDPDVRLAAEALGDLRADFVSTT
PEASPTPDQSSQQPPRQEPLLSLLTTSHPLVASTIGGASSAYGGAKNLSPRFKSGAEYVEGYLTPIANTVNSVGR
VTGVEGGVRWFLGGSRRHDHPLDPELGGYSHKRRKVGEGDVDADLPGAPLTLWSADPLRFDHRSPRRLSSTSTID
TLPAYDELRSPAYTETTGSQSTASRTSPWQSRLMLSTSGLSVAMSAESLRSLKYCLRLLRWTNDHMGRVIGTLKA
TIEEYEKTRSSPAAPDATTTANPEPEPESSRVELVNRINTLKSDILKTLQNTIETVSKYAGGALPENARVLVRRH
LMSLPQRFRLATMTTDGGSSKDGESAISEGAQKVLVLAKEGLDMVTQVSGVVDGTIMSAEEWCERMDRKRQSPRD
EEEAGGAEASGDVKMA*
Coding >Ophun1|3610
ATGACCATCTCTGGTCCCCGAGACCTCGACCCGAAGCGTCATGAGCCCGTAAACATGACCGACTCGTGGAACAGC
TCGCTGGCTTATCGCCCTCCGCTGACGACGGTCAAGGGCACGCCGTCCGTCGATGCCGAAATCGATCGTCAACTC
TCCCTTGACGACCCCGACGTACGCCTGGCTGCCGAGGCCCTGGGAGACTTGAGGGCGGACTTTGTCTCGACTACG
CCAGAAGCGAGCCCCACGCCCGACCAGAGCTCACAGCAGCCACCGCGGCAAGAGCCTCTTCTGTCCCTTCTCACC
ACGTCACACCCTCTCGTCGCGAGCACCATCGGAGGCGCCAGCTCTGCCTACGGGGGCGCTAAAAACCTGTCTCCG
CGCTTCAAGTCGGGCGCCGAGTATGTCGAGGGCTATCTCACTCCCATTGCCAATACGGTAAACTCGGTCGGCCGT
GTCACCGGCGTCGAGGGTGGCGTCCGCTGGTTCCTCGGCGGTAGTCGCCGTCACGACCATCCCTTGGACCCGGAA
TTGGGCGGCTACTCTCACAAGCGACGCAAGGTGGGCGAGGGCGACGTTGATGCCGATCTGCCAGGCGCTCCTTTG
ACACTGTGGTCCGCCGACCCTCTCCGCTTCGACCATCGGAGCCCTCGTCGGTTGTCGTCGACGAGCACCATTGAC
ACGCTTCCGGCCTACGACGAGTTGCGCTCACCAGCCTACACGGAGACGACGGGCTCTCAGTCAACGGCATCGCGA
ACAAGCCCGTGGCAGTCGCGTCTGATGCTCTCGACGTCGGGTCTCAGCGTCGCCATGAGCGCCGAGAGCCTGCGT
AGCCTCAAATACTGCCTGCGTCTGCTGCGATGGACCAACGACCACATGGGCCGCGTCATCGGAACGCTCAAGGCC
ACCATCGAAGAGTACGAAAAGACTCGCTCGTCTCCGGCTGCCCCCGACGCGACGACGACGGCCAATCCCGAGCCG
GAGCCGGAGTCGTCTCGAGTGGAGCTCGTCAACCGCATCAACACGCTCAAGTCGGACATTCTCAAGACGCTTCAG
AACACCATCGAGACGGTGTCCAAGTACGCGGGCGGCGCGCTGCCGGAGAATGCGCGCGTTCTCGTTCGCCGGCAC
TTGATGAGCCTGCCCCAGCGCTTCCGTCTCGCCACCATGACTACCGACGGCGGCTCAAGCAAGGACGGCGAGTCA
GCCATCAGCGAGGGCGCGCAAAAGGTGCTGGTCCTGGCCAAGGAGGGACTCGACATGGTGACGCAGGTCAGTGGT
GTCGTCGATGGCACCATTATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACCGCAAGAGACAGTCTCCGAGGGAC
GAGGAGGAGGCTGGGGGGGCGGAAGCGAGCGGCGATGTCAAGATGGCCTAG
Transcript >Ophun1|3610
ATGACCATCTCTGGTCCCCGAGACCTCGACCCGAAGCGTCATGAGCCCGTAAACATGACCGACTCGTGGAACAGC
TCGCTGGCTTATCGCCCTCCGCTGACGACGGTCAAGGGCACGCCGTCCGTCGATGCCGAAATCGATCGTCAACTC
TCCCTTGACGACCCCGACGTACGCCTGGCTGCCGAGGCCCTGGGAGACTTGAGGGCGGACTTTGTCTCGACTACG
CCAGAAGCGAGCCCCACGCCCGACCAGAGCTCACAGCAGCCACCGCGGCAAGAGCCTCTTCTGTCCCTTCTCACC
ACGTCACACCCTCTCGTCGCGAGCACCATCGGAGGCGCCAGCTCTGCCTACGGGGGCGCTAAAAACCTGTCTCCG
CGCTTCAAGTCGGGCGCCGAGTATGTCGAGGGCTATCTCACTCCCATTGCCAATACGGTAAACTCGGTCGGCCGT
GTCACCGGCGTCGAGGGTGGCGTCCGCTGGTTCCTCGGCGGTAGTCGCCGTCACGACCATCCCTTGGACCCGGAA
TTGGGCGGCTACTCTCACAAGCGACGCAAGGTGGGCGAGGGCGACGTTGATGCCGATCTGCCAGGCGCTCCTTTG
ACACTGTGGTCCGCCGACCCTCTCCGCTTCGACCATCGGAGCCCTCGTCGGTTGTCGTCGACGAGCACCATTGAC
ACGCTTCCGGCCTACGACGAGTTGCGCTCACCAGCCTACACGGAGACGACGGGCTCTCAGTCAACGGCATCGCGA
ACAAGCCCGTGGCAGTCGCGTCTGATGCTCTCGACGTCGGGTCTCAGCGTCGCCATGAGCGCCGAGAGCCTGCGT
AGCCTCAAATACTGCCTGCGTCTGCTGCGATGGACCAACGACCACATGGGCCGCGTCATCGGAACGCTCAAGGCC
ACCATCGAAGAGTACGAAAAGACTCGCTCGTCTCCGGCTGCCCCCGACGCGACGACGACGGCCAATCCCGAGCCG
GAGCCGGAGTCGTCTCGAGTGGAGCTCGTCAACCGCATCAACACGCTCAAGTCGGACATTCTCAAGACGCTTCAG
AACACCATCGAGACGGTGTCCAAGTACGCGGGCGGCGCGCTGCCGGAGAATGCGCGCGTTCTCGTTCGCCGGCAC
TTGATGAGCCTGCCCCAGCGCTTCCGTCTCGCCACCATGACTACCGACGGCGGCTCAAGCAAGGACGGCGAGTCA
GCCATCAGCGAGGGCGCGCAAAAGGTGCTGGTCCTGGCCAAGGAGGGACTCGACATGGTGACGCAGGTCAGTGGT
GTCGTCGATGGCACCATTATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACCGCAAGAGACAGTCTCCGAGGGAC
GAGGAGGAGGCTGGGGGGGCGGAAGCGAGCGGCGATGTCAAGATGGCCTAG
Gene >Ophun1|3610
ATGACCATCTCTGGTCCCCGAGACCTCGACCCGAAGCGTCATGAGCCCGTAAACATGACCGACTCGTGGAACAGC
TCGCTGGCTTATCGCCCTCCGCTGACGACGGTCAAGGGCACGCCGTCCGTCGATGCCGAAATCGATCGTCAACTC
TCCCTTGACGACCCCGACGTACGCCTGGCTGCCGAGGCCCTGGGAGACTTGAGGGCGGGTCCGTCTCGCCCTTTC
TCTTCTTGTCTGTATCTGTCACTGATGGGCTTCACCTTCAGACTTTGTCTCGACTACGCCAGAAGCGAGCCCCAC
GCCCGACCAGAGCTCACAGCAGCCACCGCGGCAAGAGCCTCTTCTGTCCCTTCTCACCACGTCACACCCTCTCGT
CGCGAGCACCATCGGAGGCGCCAGCTCTGCCTACGGGGGCGCTAAAAACCTGTCTCCGCGCTTCAAGTCGGGCGC
CGAGTATGTCGAGGGCTATCTCACTCCCATTGCCAATACGGTAAACTCGGTCGGCCGTGTCACCGGCGTCGAGGG
TGGCGTCCGCTGGTTCCTCGGCGGTAGTCGCCGTCACGACCATCCCTTGGACCCGGAATTGGGCGGCTACTCTCA
CAAGCGACGCAAGGTGGGCGAGGGCGACGTTGATGCCGATCTGCCAGGCGCTCCTTTGACACTGTGGTCCGCCGA
CCCTCTCCGCTTCGACCATCGGAGCCCTCGTCGGTTGTCGTCGACGAGCACCATTGACACGCTTCCGGCCTACGA
CGAGTTGCGCTCACCAGCCTACACGGAGACGACGGGCTCTCAGTCAACGGCATCGCGAACAAGCCCGTGGCAGTC
GCGTCTGATGCTCTCGACGTCGGGTCTCAGCGTCGCCATGAGCGCCGAGAGCCTGCGTAGCCTCAAATACTGCCT
GCGTCTGCTGCGATGGACCAACGACCACATGGGCCGCGTCATCGGAACGCTCAAGGCCACCATCGAAGAGTACGA
AAAGACTCGCTCGTCTCCGGCTGCCCCCGACGCGACGACGACGGCCAATCCCGAGCCGGAGCCGGAGTCGTCTCG
AGTGGAGCTCGTCAACCGCATCAACACGCTCAAGTCGGACATTCTCAAGACGCTTCAGAACACCATCGAGACGGT
GTCCAAGTACGCGGGCGGCGCGCTGCCGGAGAATGCGCGCGTTCTCGTTCGCCGGCACTTGATGAGCCTGCCCCA
GCGCTTCCGTCTCGCCACCATGACTACCGACGGCGGCTCAAGCAAGGACGGCGAGTCAGCCATCAGCGAGGGCGC
GCAAAAGGTGCTGGTCCTGGCCAAGGAGGGACTCGACATGGTGACGCAGGTCAGTGGTGTCGTCGATGGCACCAT
TATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACCGCAAGAGACAGTCTCCGAGGGACGAGGAGGAGGCTGGGGG
GGCGGAAGCGAGCGGCGATGTCAAGATGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail