Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3609
Gene name
LocationContig_320:17172..20731
Strand+
Gene length (bp)3559
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08613 Cyclin Cyclin 5.0E-41 739 915
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 6.8E-35 3 187
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 1.7E-20 415 580
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 4.2E-10 211 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 16 569 5.0E-27
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 65 569 2.0E-17
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 1 569 1.0E-15
sp|P40186|PCL7_YEAST PHO85 cyclin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL7 PE=1 SV=3 812 925 4.0E-15
sp|Q7XC35|CCP41_ORYSJ Cyclin-P4-1 OS=Oryza sativa subsp. japonica GN=CYCP4-1 PE=2 SV=1 812 959 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 16 569 5.0E-27
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 65 569 2.0E-17
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 1 569 1.0E-15
sp|P40186|PCL7_YEAST PHO85 cyclin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL7 PE=1 SV=3 812 925 4.0E-15
sp|Q7XC35|CCP41_ORYSJ Cyclin-P4-1 OS=Oryza sativa subsp. japonica GN=CYCP4-1 PE=2 SV=1 812 959 5.0E-15
sp|Q9FKF6|CCU43_ARATH Cyclin-U4-3 OS=Arabidopsis thaliana GN=CYCU4-3 PE=1 SV=1 783 955 1.0E-14
sp|Q9SHD3|CCU21_ARATH Cyclin-U2-1 OS=Arabidopsis thaliana GN=CYCU2-1 PE=1 SV=1 809 925 2.0E-14
sp|Q0J9W0|CCP11_ORYSJ Cyclin-P1-1 OS=Oryza sativa subsp. japonica GN=CYCP1-1 PE=3 SV=2 818 938 6.0E-14
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 63 603 8.0E-14
sp|Q9M205|CCU22_ARATH Cyclin-U2-2 OS=Arabidopsis thaliana GN=CYCU2-2 PE=1 SV=1 809 925 1.0E-13
sp|O42979|PSL1_SCHPO PHO85 cyclin-like protein psl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psl1 PE=3 SV=1 812 929 2.0E-13
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 60 582 4.0E-13
sp|O80513|CCU41_ARATH Cyclin-U4-1 OS=Arabidopsis thaliana GN=CYCU4-1 PE=1 SV=1 812 930 8.0E-13
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 48 579 1.0E-12
sp|Q9LY16|CCU42_ARATH Cyclin-U4-2 OS=Arabidopsis thaliana GN=CYCU4-2 PE=1 SV=1 777 939 3.0E-12
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 65 567 2.0E-10
sp|Q7FAT5|CCP21_ORYSJ Cyclin-P2-1 OS=Oryza sativa subsp. japonica GN=CYCP2-1 PE=2 SV=1 820 925 3.0E-10
sp|Q54970|POXB_STRPN Pyruvate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=spxB PE=3 SV=2 210 587 4.0E-10
sp|P0AEP7|GCL_ECOLI Glyoxylate carboligase OS=Escherichia coli (strain K12) GN=gcl PE=1 SV=2 60 508 1.0E-09
sp|P0AEP8|GCL_ECO57 Glyoxylate carboligase OS=Escherichia coli O157:H7 GN=gcl PE=3 SV=2 60 508 1.0E-09
sp|Q9LJ45|CCU11_ARATH Cyclin-U1-1 OS=Arabidopsis thaliana GN=CYCU1-1 PE=1 SV=1 812 903 2.0E-09
sp|Q8LB60|CCU31_ARATH Cyclin-U3-1 OS=Arabidopsis thaliana GN=CYCU3-1 PE=1 SV=2 812 925 4.0E-09
sp|P40038|PCL6_YEAST PHO85 cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL6 PE=1 SV=1 863 935 2.0E-08
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 3 502 2.0E-08
sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 64 569 3.0E-08
sp|P53124|PCL10_YEAST PHO85 cyclin-10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL10 PE=1 SV=1 811 907 6.0E-08
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 9 502 4.0E-07
sp|Q06712|PREG_NEUCR Nuc-1 negative regulatory protein preg OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=preg PE=1 SV=1 804 926 5.0E-07
sp|Q75HV0|CCP31_ORYSJ Cyclin-P3-1 OS=Oryza sativa subsp. japonica GN=CYCP3-1 PE=3 SV=1 812 925 5.0E-07
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 60 499 1.0E-06
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 66 503 1.0E-06
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 63 314 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Yes
GO:0019901 protein kinase binding Yes
GO:0019900 kinase binding No
GO:0019899 enzyme binding No
GO:0051338 regulation of transferase activity No
GO:0051726 regulation of cell cycle No
GO:0051174 regulation of phosphorus metabolic process No
GO:0042325 regulation of phosphorylation No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No
GO:1901681 sulfur compound binding No
GO:0050997 quaternary ammonium group binding No
GO:0001932 regulation of protein phosphorylation No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0019842 vitamin binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0051246 regulation of protein metabolic process No
GO:0065007 biological regulation No
GO:0031399 regulation of protein modification process No
GO:0080090 regulation of primary metabolic process No
GO:1904029 regulation of cyclin-dependent protein kinase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0071900 regulation of protein serine/threonine kinase activity No
GO:0043169 cation binding No
GO:0050794 regulation of cellular process No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0045859 regulation of protein kinase activity No
GO:0050790 regulation of catalytic activity No
GO:0065009 regulation of molecular function No
GO:0003674 molecular_function No
GO:0043549 regulation of kinase activity No
GO:0005515 protein binding No
GO:0050789 regulation of biological process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup367
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|444
Ophiocordyceps australis map64 (Brazil) OphauB2|235
Ophiocordyceps camponoti-floridani Ophcf2|06959
Ophiocordyceps camponoti-rufipedis Ophun1|3609 (this protein)
Ophiocordyceps kimflemingae Ophio5|7805
Ophiocordyceps subramaniannii Hirsu2|10108
Ophiocordyceps subramaniannii Hirsu2|3065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3609
MYTASFAFLESIWEAGITHCFVNLGSDHPSIIEAIVKGKREAKGRFPRIITCPNEARMVAMSMADGYARLTGKPQ
CVIVHVDVGTQGLGAAVHNASTGRAPVLVFAGLSPFTLDGELRGSRTEYIHWIQDVPDQKQIVSQYCRFTAEIKT
GVNVKQMVNRALQFAKSDPQGPVYLCGAREVMEADIEPYTLRQRDWDPVQLGPLPQSGADSIADALAEAERPVVV
TAYGGRNHKFPDALVKLADKVKGLQVVDSGGSDMCFPADHPGWRGLRFGVDDAITQADAIVVIDCDVPWVPTRCR
PRENAKIFHIDVDPLKQQMPLFYLEAGARFRANALAAIEQITAALDDGPRAAKLKAKDLDAARSRLEHRHRQLLD
DIAKRAEPGQDGSFGTGYLSKTLKQLCPEDTLWVVEAVTNTVFVHDNLQPKIPGSWINCGGGGLGWSGGGALGVK
LATDAENGGKGKFVVQIVGDGTYLFSVPGSVYWISNRYQIPVLTIVLNNKGWHAPRRSLLLVHPDGLGSKASNEE
VNIAFNPTPDYAGIAKAAADGGIFAARVSEASKLEGVLKEAIASVQSGKTAVVDCSVMAGSPEAGLQPTTRPDAR
PPPAPLPCSDAGLVVKDAASKSDEHDLFKLPAIEALKLLSAGVELLVRLTGDVPPTPPTKTPTDPMMSGIQAEKV
EIARSHSDKNLARLSREPGNKAAVAEGSTTTIAPVGDKVPTMNTTGGGGGDGGLSRLQLYSAQLRAQQLAKQQQV
QQQQKQRQEEQSRRDDEDQDVMVDGVRLRHHTPPTLEAQPYVIVGLDAEPVNVQHEAITRKFYSKQEPPIGVNQY
LLRLHQFCPMSSAVYLATSLYIHRLAVEERAILVTRRNAHRLLLAGLRVAMKAIEDLSYPHKKFSSVGGVSELEL
ARLEISFCFLTGFELIVSEDAMRSHWETLRNGRAQKMLHDSEPPGLRLGRRPREVTPSDG*
Coding >Ophun1|3609
ATGTATACAGCCTCGTTCGCCTTCCTCGAGTCCATCTGGGAGGCTGGCATAACGCACTGCTTCGTCAACCTCGGC
TCCGACCACCCCAGCATCATCGAGGCTATAGTCAAGGGTAAGCGAGAAGCCAAGGGCCGCTTCCCGCGCATAATC
ACTTGCCCCAACGAGGCAAGAATGGTGGCCATGTCCATGGCCGACGGATACGCCAGACTAACGGGCAAGCCCCAA
TGCGTCATCGTTCACGTAGATGTCGGCACGCAGGGTCTGGGGGCCGCCGTTCACAATGCGTCCACTGGCCGCGCC
CCCGTCCTCGTCTTTGCCGGTCTTTCTCCCTTTACCCTCGATGGCGAGCTGCGAGGTAGCCGCACCGAATACATT
CACTGGATCCAAGACGTTCCGGATCAGAAGCAGATCGTTTCACAGTATTGTCGCTTCACAGCAGAGATCAAGACG
GGTGTCAATGTCAAGCAAATGGTTAATCGCGCGCTTCAGTTTGCCAAGTCCGACCCCCAAGGCCCCGTCTACCTC
TGCGGCGCCCGTGAAGTCATGGAGGCCGACATCGAACCCTACACGCTCAGGCAGCGTGATTGGGACCCGGTGCAG
CTCGGTCCTCTTCCCCAGTCCGGCGCCGACAGCATCGCCGACGCCCTAGCCGAAGCCGAGCGGCCCGTCGTCGTG
ACGGCTTATGGCGGTAGAAACCACAAGTTCCCTGACGCGCTCGTCAAGCTCGCCGACAAAGTCAAGGGACTGCAG
GTGGTCGATTCGGGCGGCAGCGACATGTGCTTCCCCGCCGACCATCCAGGATGGAGGGGTCTCCGGTTTGGTGTC
GACGATGCCATTACTCAAGCCGATGCCATCGTCGTCATTGACTGCGACGTGCCATGGGTCCCTACGCGCTGCAGG
CCGCGCGAGAACGCCAAGATCTTCCACATCGATGTCGATCCGCTGAAGCAGCAGATGCCCCTGTTCTACCTCGAA
GCCGGGGCCAGATTCCGCGCCAATGCCCTGGCGGCGATCGAGCAAATCACCGCCGCTCTCGACGACGGACCCCGA
GCCGCCAAGCTCAAGGCCAAAGACTTGGACGCAGCGCGCAGCAGGCTAGAACATAGACACCGCCAACTTCTGGAC
GACATCGCTAAAAGGGCCGAGCCGGGACAGGACGGCAGTTTCGGCACCGGCTACCTGTCCAAGACACTCAAGCAG
CTGTGTCCCGAGGATACGCTCTGGGTTGTCGAGGCTGTCACCAACACAGTCTTTGTGCACGATAACCTGCAGCCG
AAGATACCCGGCTCTTGGATCAACTGCGGTGGCGGCGGCCTCGGCTGGTCTGGGGGCGGCGCTCTGGGCGTGAAG
CTGGCGACGGACGCAGAGAATGGAGGCAAGGGCAAGTTTGTCGTGCAAATTGTCGGAGACGGCACCTACCTGTTC
TCTGTCCCGGGCAGCGTCTACTGGATCTCGAACCGATACCAGATTCCCGTCCTGACGATTGTGCTCAACAACAAG
GGCTGGCACGCGCCGCGCCGTTCCCTGCTATTGGTGCATCCAGATGGTCTGGGATCCAAGGCGAGCAACGAGGAA
GTCAACATTGCGTTCAATCCAACGCCTGACTACGCCGGCATCGCCAAGGCAGCGGCCGACGGAGGCATATTCGCG
GCACGCGTGTCCGAGGCGTCGAAGCTGGAGGGCGTGTTGAAGGAGGCCATCGCCAGCGTTCAATCGGGAAAGACG
GCGGTTGTGGACTGCTCGGTTATGGCTGGCTCGCCTGAAGCAGGCCTTCAGCCGACGACGCGCCCGGATGCGCGT
CCGCCGCCTGCGCCACTGCCCTGTTCCGACGCTGGGCTCGTCGTCAAGGACGCGGCGTCGAAATCAGACGAGCAT
GATCTGTTCAAGCTGCCGGCCATCGAGGCGCTCAAGCTGCTGAGCGCGGGCGTAGAGCTCCTCGTCCGCCTGACG
GGCGATGTCCCGCCTACGCCGCCGACCAAGACGCCGACAGATCCGATGATGAGCGGGATTCAGGCGGAAAAGGTG
GAAATTGCGCGCTCCCACTCGGACAAGAACCTGGCGCGGCTGTCGCGGGAGCCAGGCAACAAGGCCGCAGTGGCC
GAGGGCTCGACAACGACGATTGCGCCGGTCGGTGACAAGGTTCCCACGATGAATACGACCGGTGGCGGAGGCGGA
GACGGGGGGCTGAGCAGGTTGCAGCTCTATAGCGCACAGCTCAGGGCGCAGCAGCTGGCCAAGCAGCAGCAGGTC
CAGCAGCAGCAGAAACAGCGTCAGGAGGAACAGTCGCGACGGGACGACGAGGATCAGGACGTCATGGTGGATGGC
GTCCGGCTGCGACACCATACGCCACCAACGCTGGAAGCGCAACCCTACGTCATCGTAGGACTCGACGCAGAGCCC
GTCAACGTCCAGCACGAGGCCATCACGCGCAAGTTTTACAGCAAGCAGGAGCCGCCGATTGGGGTTAATCAGTAT
CTGCTGCGGCTGCATCAGTTCTGTCCCATGTCTTCGGCCGTCTACCTCGCTACGTCGCTCTACATCCATCGGCTG
GCGGTTGAGGAGCGCGCTATCCTGGTGACGCGGCGAAATGCGCACCGGTTGTTACTGGCTGGTTTGCGGGTCGCG
ATGAAGGCGATTGAGGATCTGTCATATCCGCACAAGAAGTTTTCGAGCGTCGGAGGCGTCAGTGAGCTGGAGCTA
GCGCGGCTGGAAATAAGTTTCTGCTTCCTTACCGGCTTCGAGCTCATCGTTAGCGAGGATGCGATGCGGAGCCAT
TGGGAGACGCTACGAAATGGTCGAGCGCAAAAGATGCTTCATGATAGCGAGCCGCCGGGCCTTCGGTTGGGGAGG
AGACCTCGCGAAGTGACGCCCTCGGACGGATGA
Transcript >Ophun1|3609
ATGTATACAGCCTCGTTCGCCTTCCTCGAGTCCATCTGGGAGGCTGGCATAACGCACTGCTTCGTCAACCTCGGC
TCCGACCACCCCAGCATCATCGAGGCTATAGTCAAGGGTAAGCGAGAAGCCAAGGGCCGCTTCCCGCGCATAATC
ACTTGCCCCAACGAGGCAAGAATGGTGGCCATGTCCATGGCCGACGGATACGCCAGACTAACGGGCAAGCCCCAA
TGCGTCATCGTTCACGTAGATGTCGGCACGCAGGGTCTGGGGGCCGCCGTTCACAATGCGTCCACTGGCCGCGCC
CCCGTCCTCGTCTTTGCCGGTCTTTCTCCCTTTACCCTCGATGGCGAGCTGCGAGGTAGCCGCACCGAATACATT
CACTGGATCCAAGACGTTCCGGATCAGAAGCAGATCGTTTCACAGTATTGTCGCTTCACAGCAGAGATCAAGACG
GGTGTCAATGTCAAGCAAATGGTTAATCGCGCGCTTCAGTTTGCCAAGTCCGACCCCCAAGGCCCCGTCTACCTC
TGCGGCGCCCGTGAAGTCATGGAGGCCGACATCGAACCCTACACGCTCAGGCAGCGTGATTGGGACCCGGTGCAG
CTCGGTCCTCTTCCCCAGTCCGGCGCCGACAGCATCGCCGACGCCCTAGCCGAAGCCGAGCGGCCCGTCGTCGTG
ACGGCTTATGGCGGTAGAAACCACAAGTTCCCTGACGCGCTCGTCAAGCTCGCCGACAAAGTCAAGGGACTGCAG
GTGGTCGATTCGGGCGGCAGCGACATGTGCTTCCCCGCCGACCATCCAGGATGGAGGGGTCTCCGGTTTGGTGTC
GACGATGCCATTACTCAAGCCGATGCCATCGTCGTCATTGACTGCGACGTGCCATGGGTCCCTACGCGCTGCAGG
CCGCGCGAGAACGCCAAGATCTTCCACATCGATGTCGATCCGCTGAAGCAGCAGATGCCCCTGTTCTACCTCGAA
GCCGGGGCCAGATTCCGCGCCAATGCCCTGGCGGCGATCGAGCAAATCACCGCCGCTCTCGACGACGGACCCCGA
GCCGCCAAGCTCAAGGCCAAAGACTTGGACGCAGCGCGCAGCAGGCTAGAACATAGACACCGCCAACTTCTGGAC
GACATCGCTAAAAGGGCCGAGCCGGGACAGGACGGCAGTTTCGGCACCGGCTACCTGTCCAAGACACTCAAGCAG
CTGTGTCCCGAGGATACGCTCTGGGTTGTCGAGGCTGTCACCAACACAGTCTTTGTGCACGATAACCTGCAGCCG
AAGATACCCGGCTCTTGGATCAACTGCGGTGGCGGCGGCCTCGGCTGGTCTGGGGGCGGCGCTCTGGGCGTGAAG
CTGGCGACGGACGCAGAGAATGGAGGCAAGGGCAAGTTTGTCGTGCAAATTGTCGGAGACGGCACCTACCTGTTC
TCTGTCCCGGGCAGCGTCTACTGGATCTCGAACCGATACCAGATTCCCGTCCTGACGATTGTGCTCAACAACAAG
GGCTGGCACGCGCCGCGCCGTTCCCTGCTATTGGTGCATCCAGATGGTCTGGGATCCAAGGCGAGCAACGAGGAA
GTCAACATTGCGTTCAATCCAACGCCTGACTACGCCGGCATCGCCAAGGCAGCGGCCGACGGAGGCATATTCGCG
GCACGCGTGTCCGAGGCGTCGAAGCTGGAGGGCGTGTTGAAGGAGGCCATCGCCAGCGTTCAATCGGGAAAGACG
GCGGTTGTGGACTGCTCGGTTATGGCTGGCTCGCCTGAAGCAGGCCTTCAGCCGACGACGCGCCCGGATGCGCGT
CCGCCGCCTGCGCCACTGCCCTGTTCCGACGCTGGGCTCGTCGTCAAGGACGCGGCGTCGAAATCAGACGAGCAT
GATCTGTTCAAGCTGCCGGCCATCGAGGCGCTCAAGCTGCTGAGCGCGGGCGTAGAGCTCCTCGTCCGCCTGACG
GGCGATGTCCCGCCTACGCCGCCGACCAAGACGCCGACAGATCCGATGATGAGCGGGATTCAGGCGGAAAAGGTG
GAAATTGCGCGCTCCCACTCGGACAAGAACCTGGCGCGGCTGTCGCGGGAGCCAGGCAACAAGGCCGCAGTGGCC
GAGGGCTCGACAACGACGATTGCGCCGGTCGGTGACAAGGTTCCCACGATGAATACGACCGGTGGCGGAGGCGGA
GACGGGGGGCTGAGCAGGTTGCAGCTCTATAGCGCACAGCTCAGGGCGCAGCAGCTGGCCAAGCAGCAGCAGGTC
CAGCAGCAGCAGAAACAGCGTCAGGAGGAACAGTCGCGACGGGACGACGAGGATCAGGACGTCATGGTGGATGGC
GTCCGGCTGCGACACCATACGCCACCAACGCTGGAAGCGCAACCCTACGTCATCGTAGGACTCGACGCAGAGCCC
GTCAACGTCCAGCACGAGGCCATCACGCGCAAGTTTTACAGCAAGCAGGAGCCGCCGATTGGGGTTAATCAGTAT
CTGCTGCGGCTGCATCAGTTCTGTCCCATGTCTTCGGCCGTCTACCTCGCTACGTCGCTCTACATCCATCGGCTG
GCGGTTGAGGAGCGCGCTATCCTGGTGACGCGGCGAAATGCGCACCGGTTGTTACTGGCTGGTTTGCGGGTCGCG
ATGAAGGCGATTGAGGATCTGTCATATCCGCACAAGAAGTTTTCGAGCGTCGGAGGCGTCAGTGAGCTGGAGCTA
GCGCGGCTGGAAATAAGTTTCTGCTTCCTTACCGGCTTCGAGCTCATCGTTAGCGAGGATGCGATGCGGAGCCAT
TGGGAGACGCTACGAAATGGTCGAGCGCAAAAGATGCTTCATGATAGCGAGCCGCCGGGCCTTCGGTTGGGGAGG
AGACCTCGCGAAGTGACGCCCTCGGACGGATGA
Gene >Ophun1|3609
ATGTATACAGCCTCGTTCGCCTTCCTCGAGTCCATCTGGGAGGCTGGCATAACGCACTGCTTCGTCAACCTCGGC
TCCGACCACCCCAGCATCATCGAGGCTATAGTCAAGGGTAAGCGAGAAGCCAAGGGCCGCTTCCCGCGCATAATC
ACTTGCCCCAACGAGGCAAGAGTCCCTTGCGCTGTGGTGACGTCGAGTACTGCAACGCTGAACGATGTCCTTAGA
TGGTGGCCATGTCCATGGCCGACGGATACGCCAGACTAACGGGCAAGCCCCAATGCGTCATCGTTCACGTAGATG
TCGGCACGCAGGGTCTGGGGGCCGCCGTTCACAATGCGTCCACTGGCCGCGCCCCCGTCCTCGTCTTTGCCGGTC
TTTCTCCCTTTACCCTCGATGGCGAGCTGCGAGGTAGCCGCACCGAATACATTCACTGGATCCAAGACGTTCCGG
ATCAGAAGCAGATCGTTTCACAGTATTGTCGCTTCACAGCAGAGATCAAGACGGGTGTCAATGTCAAGCAAATGG
TTAATCGCGCGCTTCAGTTTGCCAAGTCCGACCCCCAAGGCCCCGTCTACCTCTGCGGCGCCCGTGAAGTCATGG
AGGCCGACATCGAACCCTACACGCTCAGGCAGCGTGATTGGGACCCGGTGCAGCTCGGTCCTCTTCCCCAGTCCG
GCGCCGACAGCATCGCCGACGCCCTAGCCGAAGCCGAGCGGCCCGTCGTCGTGACGGCTTATGGCGGTAGAAACC
ACAAGTTCCCTGACGCGCTCGTCAAGCTCGCCGACAAAGTCAAGGGACTGCAGGTGGTCGATTCGGGCGGCAGCG
ACATGTGCTTCCCCGCCGACCATCCAGGATGGAGGGGTCTCCGGTTTGGTGTCGACGATGCCATTACTCAAGCCG
ATGCCATCGTCGTCATTGACTGCGACGTGCCATGGGTCCCTACGCGCTGCAGGCCGCGCGAGAACGCCAAGATCT
TCCACATCGATGTCGATCCGCTGAAGCAGCAGATGCCCCTGTTCTACCTCGAAGCCGGGGCCAGATTCCGCGCCA
ATGCCCTGGCGGCGATCGAGCAAATCACCGCCGCTCTCGACGACGGACCCCGAGCCGCCAAGCTCAAGGCCAAAG
ACTTGGACGCAGCGCGCAGCAGGCTAGAACATAGACACCGCCAACTTCTGGACGACATCGCTAAAAGGGCCGAGC
CGGGACAGGACGGCAGTTTCGGCACCGGCTACCTGTCCAAGACACTCAAGCAGCTGTGTCCCGAGGATACGCTCT
GGGTTGTCGAGGCTGTCACCAACACAGTCTTTGTGCACGATAACCTGCAGCCGAAGATACCCGGCTCTTGGATCA
ACTGCGGTGGCGGCGGCCTCGGCTGGTCTGGGGGCGGCGCTCTGGGCGTGAAGCTGGCGACGGACGCAGAGAATG
GAGGCAAGGGCAAGTTTGTCGTGCAAATTGTCGGAGACGGCACCTACCTGTTCTCTGTCCCGGGCAGCGTCTACT
GGATCTCGAACCGATACCAGATTCCCGTCCTGACGATTGTGCTCAACAACAAGGGTAAGTGTCGCAGAAGAGGTG
CGAAGACTATTCGCTAACTTGTCCGCAGGCTGGCACGCGCCGCGCCGTTCCCTGCTATTGGTGCATCCAGATGGT
CTGGGATCCAAGGCGAGCAACGAGGAAGTCAACATTGCGTTCAATCCAACGCCTGACTACGCCGGCATCGCCAAG
GCAGCGGCCGACGGAGGCATATTCGCGGCACGCGTGTCCGAGGCGTCGAAGCTGGAGGGCGTGTTGAAGGAGGCC
ATCGCCAGCGTTCAATCGGGAAAGACGGCGGTTGTGGACTGCTCGGTTATGGCTGGCTGTTAGGCATGCAAGACG
CAATGAGAAACGGCTGCACACAGGATCAGATACAGGTGAATAGAACCGTGGATTGCTGCAGACGGCCAAGACGTT
GTAGACTGAGGCTAGGCCAAGTCATTGGTAGCCTACCCTAGACATCAGGGACCAGCACTAGTAGCATCAAAACAC
CAGGAGATGGTGGGGTTTCATGCTAATTCTTCTCCTGCAAATCGTCGATTCAGCAGCTCGAGCGCTCCTCTAGTA
CGTGCAGCGGCCACTTCTGGTTCGTCAACAGCCGGCTTGCTCCATCGCTTACATTTCCCGATTCAACGCGGCTGA
TAGAGGAAGAACTCGAAATCGCGAGAGACGAAGACGAGAAGAAAGAAAACAACGACGAAGACGAGACCAACGCAG
ACCATCATCGACATGTACGCGCGCAGCCAGCCGCCGCTCGCCGCCTCCACCGTCGGTCACTGCTAAGTCGAAGAA
GCAAGCGTCCATGTCGACAGCGTCGTCTCTCCCCCCAGCGCCTGAAGCAGGCCTTCAGCCGACGACGCGCCCGGA
TGCGCGTCCGCCGCCTGCGCCACTGCCCTGTTCCGACGCTGGGCTCGTCGTCAAGGACGCGGCGTCGAAATCAGA
CGAGCATGATCTGTTCAAGCTGCCGGCCATCGAGGCGCTCAAGCTGCTGAGCGCGGGCGTAGAGCTCCTCGTCCG
CCTGACGGGCGATGTCCCGCCTACGCCGCCGACCAAGACGCCGACAGATCCGATGATGAGCGGGATTCAGGCGGA
AAAGGTGGAAATTGCGCGCTCCCACTCGGACAAGAACCTGGCGCGGCTGTCGCGGGAGCCAGGCAACAAGGCCGC
AGTGGCCGAGGGCTCGACAACGACGATTGCGCCGGTCGGTGACAAGGTTCCCACGATGAATACGACCGGTGGCGG
AGGCGGAGACGGGGGGCTGAGCAGGTTGCAGCTCTATAGCGCACAGCTCAGGGCGCAGCAGCTGGCCAAGCAGCA
GCAGGTCCAGCAGCAGCAGAAACAGCGTCAGGAGGAACAGTCGCGACGGGACGACGAGGATCAGGACGTCATGGT
GGATGGCGTCCGGCTGCGACACCATACGCCACCAACGCTGGAAGCGCAACCCTACGTCATCGTAGGACTCGACGC
AGAGCCCGTCAACGTCCAGCACGAGGCCATCACGCGCAAGTTTTACAGCAAGCAGGAGCCGCCGATTGGGGTTAA
TCAGTATCTGCTGCGGCTGCATCAGTTCTGTCCCATGTCTTCGGCCGTCTACCTCGCTACGTCGCTCTACATCCA
TCGGCTGGCGGTTGAGGAGCGCGCTATCCTGGTGACGCGGCGAAATGCGCACCGGTTGTTACTGGCTGGTTTGCG
GGTCGCGATGAAGGTGAATTATCCTTGCTTCTCTCTGGCCCGACCAGGGACTTGTGTTGGCGGAACTGACTTGGC
TGTCCAGGCGATTGAGGATCTGTCATATCCGCACAAGAAGTTTTCGAGCGTCGGAGGCGTCAGTGAGCTGGAGCT
AGCGCGGCTGGAAATAAGTTTCTGCTTCCTTACCGGCTTCGAGCTCATCGTTAGCGAGGATGCGATGCGGAGCCA
TTGGGAGACGCTACGAAATGGTCGAGCGCAAAAGATGCTTCATGATAGCGAGCCGCCGGGCCTTCGGTTGGGGAG
GAGACCTCGCGAAGTGACGCCCTCGGACGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail