Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3605
Gene name
LocationContig_320:2516..3114
Strand-
Gene length (bp)598
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01627 Hpt Hpt domain 3.3E-12 51 129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94321|MPR1_SCHPO Multistep phosphorelay regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpr1 PE=1 SV=1 25 148 7.0E-33
sp|Q59WC6|YPD1_CANAL Phosphorelay intermediate protein YPD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YPD1 PE=3 SV=1 19 111 1.0E-20
sp|Q07688|YPD1_YEAST Phosphorelay intermediate protein YPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPD1 PE=1 SV=1 48 106 2.0E-10

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0035556 intracellular signal transduction No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3605
MAPTDDKACTTSLEDGLNQMLGDAVDMNTFNQILEMDEPGDREFSSSIVFSFFNQAEETFESMDKALEKKDLEKL
AGLGHFLKGSSATLGLVKVRDGCEKIERYGKNENADGSTEPDSELCLKLISEALRTVKVDYKDVERILKRYYEGD
KLKSDDA*
Coding >Ophun1|3605
ATGGCGCCGACCGACGACAAGGCATGCACTACTTCGCTCGAGGACGGGCTCAACCAGATGCTGGGCGATGCCGTC
GATATGAACACGTTTAATCAGATACTCGAGATGGACGAGCCCGGCGATCGCGAGTTCAGCTCCTCCATCGTCTTC
AGCTTCTTCAACCAGGCCGAGGAGACGTTCGAATCTATGGACAAGGCGCTGGAAAAAAAGGATCTGGAAAAACTG
GCTGGACTCGGTCACTTTCTCAAAGGCTCTTCTGCCACACTGGGCCTCGTCAAGGTGCGCGATGGGTGCGAGAAG
ATTGAGCGATACGGCAAAAACGAAAACGCGGATGGGTCGACGGAGCCAGATTCTGAATTGTGTCTGAAGCTCATC
AGCGAGGCTCTCAGGACGGTAAAGGTCGATTACAAGGACGTCGAGCGCATTCTTAAGAGGTACTACGAGGGCGAT
AAGCTCAAAAGCGACGACGCATGA
Transcript >Ophun1|3605
ATGGCGCCGACCGACGACAAGGCATGCACTACTTCGCTCGAGGACGGGCTCAACCAGATGCTGGGCGATGCCGTC
GATATGAACACGTTTAATCAGATACTCGAGATGGACGAGCCCGGCGATCGCGAGTTCAGCTCCTCCATCGTCTTC
AGCTTCTTCAACCAGGCCGAGGAGACGTTCGAATCTATGGACAAGGCGCTGGAAAAAAAGGATCTGGAAAAACTG
GCTGGACTCGGTCACTTTCTCAAAGGCTCTTCTGCCACACTGGGCCTCGTCAAGGTGCGCGATGGGTGCGAGAAG
ATTGAGCGATACGGCAAAAACGAAAACGCGGATGGGTCGACGGAGCCAGATTCTGAATTGTGTCTGAAGCTCATC
AGCGAGGCTCTCAGGACGGTAAAGGTCGATTACAAGGACGTCGAGCGCATTCTTAAGAGGTACTACGAGGGCGAT
AAGCTCAAAAGCGACGACGCATGA
Gene >Ophun1|3605
ATGGCGCCGACCGACGACAAGGCATGCACTGTTCCCCGATGATTCGAGTCCGATCGCGCTGGTGGCTGACGGCGA
GTTCCAGACTTCGCTCGAGGACGGGCTCAACCAGATGCTGGGCGATGCCGTCGATATGAACACGTTTAATCAGAT
ACTCGAGATGGACGAGCCCGGCGATCGCGAGTTCAGCTCCTCCATCGTCTTCAGCTTCTTCAACCAGGCCGAGGA
GACGTTCGAATCTATGGACAAGGCGCTGTGAGTGTTTTTTTTCTCCAGATTTTTTTTTTTTTTCTGGAGACGAGG
CCTGTCCCCGCTTAACAGTCTCAGGGAAAAAAAGGATCTGGAAAAACTGGCTGGACTCGGTCACTTTCTCAAAGG
CTCTTCTGCCACACTGGGCCTCGTCAAGGTGCGCGATGGGTGCGAGAAGATTGAGCGATACGGCAAAAACGAAAA
CGCGGATGGGTCGACGGAGCCAGATTCTGAATTGTGTCTGAAGCTCATCAGCGAGGCTCTCAGGACGGTAAAGGT
CGATTACAAGGACGTCGAGCGCATTCTTAAGAGGTACTACGAGGGCGATAAGCTCAAAAGCGACGACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail