Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3602
Gene name
LocationContig_32:55642..57421
Strand+
Gene length (bp)1779
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.3E-09 46 147

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2156
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6376
Ophiocordyceps australis map64 (Brazil) OphauB2|7595
Ophiocordyceps camponoti-floridani Ophcf2|02542
Ophiocordyceps camponoti-rufipedis Ophun1|3602 (this protein)
Ophiocordyceps kimflemingae Ophio5|970
Ophiocordyceps subramaniannii Hirsu2|265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3602
MVRRNSVGELGFFDLEAEESRDSDSNSSGSDSESDDASSSSSGTSFSCFMQFPPELRARVWEMFCSDLEAKARVL
RFMVMPNSEFAGNLVVSPNVIDQTRPLRRLMAVHRESRRLAKVVYPHTLHFKADYDGKEDASMVFNQYSDIIALV
SPFVRMEFSIPALQTEPIRNLAFPMLRVDEPPGPSSMTTRILRLFRNFPNLKRLFHQIDDWDIRTRRIRWVVSER
THQVLVETFEEKPGVGENTQTVYCWPDIDVFPDFAMPEDLDPFLTKDVSRLTQDRGIKLLPMVTFTFEDSVGRYR
HLLKNRDEPHLESDGHHNGEDSSADDDSDESTGTDLDEYESEGIDDSDLDDDDEEEDNTGAIPVQGENLEDSDQD
SLLQAARDPSEARFSSPELDEEQSVKQTERGSFKRKIVIDSDDDDDCGDDDDDDDDDHETRVKRPRLARRIVSDS
DDDGDEDDDEAVNGGSSSRRRAASCKSESSGTSDDEPVHGATSSRRRTGPADVESSSSSEDNEDDESVRGGPTSR
LRAAPSDVEPSDGRSEQQTSDTSSDDGDSVEEEDPQDDDEGDGSDGDDLIDGAISEDSAGSSHEEDE*
Coding >Ophun1|3602
ATGGTCAGGCGCAATAGCGTCGGGGAGCTGGGCTTCTTCGACCTCGAGGCCGAGGAATCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGAGAGCGACGACGCTTCCTCTTCTTCGTCCGGAACTTCCTTCTCCTGCTTTATG
CAGTTTCCCCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCCGACCTCGAAGCCAAGGCCCGCGTCCTG
CGCTTCATGGTCATGCCAAACTCCGAATTTGCCGGTAATCTCGTCGTCTCCCCCAATGTTATTGATCAGACGAGG
CCTCTGCGACGCCTCATGGCCGTCCATCGCGAGTCGCGCCGTCTAGCCAAGGTTGTCTACCCCCACACCCTCCAT
TTCAAGGCCGACTACGACGGCAAAGAGGACGCTTCTATGGTGTTTAACCAGTATTCCGATATCATCGCCCTCGTT
TCTCCCTTTGTCAGAATGGAATTCTCCATACCAGCGCTCCAGACCGAGCCTATCCGGAACCTCGCTTTCCCCATG
TTGCGCGTTGACGAACCTCCGGGACCTTCGTCCATGACGACGCGCATTTTGCGTTTGTTCCGCAACTTTCCCAAC
TTGAAAAGACTCTTTCATCAGATTGATGACTGGGACATCCGAACTCGCCGTATCCGTTGGGTCGTGTCCGAACGC
ACCCATCAAGTACTGGTCGAGACGTTTGAGGAGAAGCCTGGTGTAGGTGAAAACACACAGACTGTTTACTGCTGG
CCCGACATCGACGTGTTTCCTGACTTTGCGATGCCGGAAGACCTCGATCCGTTCCTCACCAAAGACGTTTCGCGT
CTCACCCAGGACCGTGGCATTAAACTCTTGCCCATGGTTACCTTCACGTTTGAGGACTCCGTCGGACGTTACCGG
CATCTGCTGAAGAACAGAGACGAACCCCATCTCGAGTCCGATGGTCACCATAATGGTGAAGATAGCAGTGCTGAT
GACGATTCTGACGAGTCTACCGGTACCGATCTAGACGAGTACGAGAGCGAGGGTATCGACGATTCCGATTTAGAT
GATGACGACGAGGAAGAGGACAACACTGGTGCTATCCCAGTCCAAGGGGAGAATCTCGAGGATAGTGACCAAGAT
AGCCTTCTCCAGGCCGCCCGTGACCCTTCCGAAGCGAGGTTTTCGAGTCCTGAGCTGGATGAGGAACAATCTGTT
AAACAAACCGAGCGTGGGTCTTTCAAGCGCAAGATTGTCATAGACTCCGACGATGATGACGACTGTGGCGACGAC
GACGACGATGACGACGACGACCACGAGACTAGGGTCAAGCGCCCTCGCCTGGCTCGCCGCATCGTTTCCGACTCG
GACGACGATGGCGATGAGGACGACGATGAAGCTGTCAACGGCGGGTCATCGTCTCGACGCCGCGCTGCCTCATGC
AAATCCGAATCGTCTGGCACTTCCGACGATGAGCCCGTCCACGGCGCTACGTCGTCTCGTCGCCGAACCGGCCCT
GCCGACGTTGAATCGTCTAGCTCTTCCGAGGACAATGAAGATGACGAATCCGTTCGCGGTGGGCCAACGTCTCGC
CTCCGCGCCGCCCCATCCGATGTCGAACCGTCCGATGGCCGTTCGGAGCAGCAGACGTCAGACACGTCGTCCGAC
GACGGGGACTCAGTAGAGGAAGAAGACCCCCAGGACGACGACGAGGGCGATGGCTCCGACGGAGACGACCTGATC
GACGGTGCGATTTCGGAGGACAGCGCGGGAAGCAGTCACGAAGAGGACGAGTAA
Transcript >Ophun1|3602
ATGGTCAGGCGCAATAGCGTCGGGGAGCTGGGCTTCTTCGACCTCGAGGCCGAGGAATCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGAGAGCGACGACGCTTCCTCTTCTTCGTCCGGAACTTCCTTCTCCTGCTTTATG
CAGTTTCCCCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCCGACCTCGAAGCCAAGGCCCGCGTCCTG
CGCTTCATGGTCATGCCAAACTCCGAATTTGCCGGTAATCTCGTCGTCTCCCCCAATGTTATTGATCAGACGAGG
CCTCTGCGACGCCTCATGGCCGTCCATCGCGAGTCGCGCCGTCTAGCCAAGGTTGTCTACCCCCACACCCTCCAT
TTCAAGGCCGACTACGACGGCAAAGAGGACGCTTCTATGGTGTTTAACCAGTATTCCGATATCATCGCCCTCGTT
TCTCCCTTTGTCAGAATGGAATTCTCCATACCAGCGCTCCAGACCGAGCCTATCCGGAACCTCGCTTTCCCCATG
TTGCGCGTTGACGAACCTCCGGGACCTTCGTCCATGACGACGCGCATTTTGCGTTTGTTCCGCAACTTTCCCAAC
TTGAAAAGACTCTTTCATCAGATTGATGACTGGGACATCCGAACTCGCCGTATCCGTTGGGTCGTGTCCGAACGC
ACCCATCAAGTACTGGTCGAGACGTTTGAGGAGAAGCCTGGTGTAGGTGAAAACACACAGACTGTTTACTGCTGG
CCCGACATCGACGTGTTTCCTGACTTTGCGATGCCGGAAGACCTCGATCCGTTCCTCACCAAAGACGTTTCGCGT
CTCACCCAGGACCGTGGCATTAAACTCTTGCCCATGGTTACCTTCACGTTTGAGGACTCCGTCGGACGTTACCGG
CATCTGCTGAAGAACAGAGACGAACCCCATCTCGAGTCCGATGGTCACCATAATGGTGAAGATAGCAGTGCTGAT
GACGATTCTGACGAGTCTACCGGTACCGATCTAGACGAGTACGAGAGCGAGGGTATCGACGATTCCGATTTAGAT
GATGACGACGAGGAAGAGGACAACACTGGTGCTATCCCAGTCCAAGGGGAGAATCTCGAGGATAGTGACCAAGAT
AGCCTTCTCCAGGCCGCCCGTGACCCTTCCGAAGCGAGGTTTTCGAGTCCTGAGCTGGATGAGGAACAATCTGTT
AAACAAACCGAGCGTGGGTCTTTCAAGCGCAAGATTGTCATAGACTCCGACGATGATGACGACTGTGGCGACGAC
GACGACGATGACGACGACGACCACGAGACTAGGGTCAAGCGCCCTCGCCTGGCTCGCCGCATCGTTTCCGACTCG
GACGACGATGGCGATGAGGACGACGATGAAGCTGTCAACGGCGGGTCATCGTCTCGACGCCGCGCTGCCTCATGC
AAATCCGAATCGTCTGGCACTTCCGACGATGAGCCCGTCCACGGCGCTACGTCGTCTCGTCGCCGAACCGGCCCT
GCCGACGTTGAATCGTCTAGCTCTTCCGAGGACAATGAAGATGACGAATCCGTTCGCGGTGGGCCAACGTCTCGC
CTCCGCGCCGCCCCATCCGATGTCGAACCGTCCGATGGCCGTTCGGAGCAGCAGACGTCAGACACGTCGTCCGAC
GACGGGGACTCAGTAGAGGAAGAAGACCCCCAGGACGACGACGAGGGCGATGGCTCCGACGGAGACGACCTGATC
GACGGTGCGATTTCGGAGGACAGCGCGGGAAGCAGTCACGAAGAGGACGAGTAA
Gene >Ophun1|3602
ATGGTCAGGCGCAATAGCGTCGGGGAGCTGGGCTTCTTCGACCTCGAGGCCGAGGAATCCCGCGACAGCGACTCC
AACTCGAGCGGCAGCGACTCCGAGAGCGACGACGCTTCCTCTTCTTCGTCCGGAACTTCCTTCTCCTGCTTTATG
CAGTTTCCCCCCGAGCTTCGCGCTCGCGTCTGGGAAATGTTCTGCTCCGACCTCGAAGCCAAGGCCCGCGTCCTG
CGCTTCATGGTCATGCCAAACTCCGAATTTGCCGGTAATCTCGTCGTCTCCCCCAATGTTATTGATCAGACGAGG
CCTCTGCGACGCCTCATGGCCGTCCATCGCGAGTCGCGCCGTCTAGCCAAGGTTGTCTACCCCCACACCCTCCAT
TTCAAGGCCGACTACGACGGCAAAGAGGACGCTTCTATGGTGTTTAACCAGTATTCCGATATCATCGCCCTCGTT
TCTCCCTTTGTCAGAATGGAATTCTCCATACCAGCGCTCCAGACCGAGCCTATCCGGAACCTCGCTTTCCCCATG
TTGCGCGTTGACGAACCTCCGGGACCTTCGTCCATGACGACGCGCATTTTGCGTTTGTTCCGCAACTTTCCCAAC
TTGAAAAGACTCTTTCATCAGATTGATGACTGGGACATCCGAACTCGCCGTATCCGTTGGGTCGTGTCCGAACGC
ACCCATCAAGTACTGGTCGAGACGTTTGAGGAGAAGCCTGGTGTAGGTGAAAACACACAGACTGTTTACTGCTGG
CCCGACATCGACGTGTTTCCTGACTTTGCGATGCCGGAAGACCTCGATCCGTTCCTCACCAAAGACGTTTCGCGT
CTCACCCAGGACCGTGGCATTAAACTCTTGCCCATGGTTACCTTCACGTTTGAGGACTCCGTCGGACGTTACCGG
CATCTGCTGAAGAACAGAGACGAACCCCATCTCGAGTCCGATGGTCACCATAATGGTGAAGATAGCAGTGCTGAT
GACGATTCTGACGAGTCTACCGGTACCGATCTAGACGAGTACGAGAGCGAGGGTATCGACGATTCCGATTTAGAT
GATGACGACGAGGAAGAGGACAACACTGGTGCTATCCCAGTCCAAGGGGAGAATCTCGAGGATAGTGACCAAGAT
AGCCTTCTCCAGGCCGCCCGTGACCCTTCCGAAGCGAGGTTTTCGAGTCCTGAGCTGGATGAGGAACAATCTGTT
AAACAAACCGAGCGTGGGTCTTTCAAGCGCAAGATTGTCATAGACTCCGACGATGATGACGACTGTGGCGACGAC
GACGACGATGACGACGACGACCACGAGACTAGGGTCAAGCGCCCTCGCCTGGCTCGCCGCATCGTTTCCGACTCG
GACGACGATGGCGATGAGGACGACGATGAAGCTGTCAACGGCGGGTCATCGTCTCGACGCCGCGCTGCCTCATGC
AAATCCGAATCGTCTGGCACTTCCGACGATGAGCCCGTCCACGGCGCTACGTCGTCTCGTCGCCGAACCGGCCCT
GCCGACGTTGAATCGTCTAGCTCTTCCGAGGACAATGAAGATGACGAATCCGTTCGCGGTGGGCCAACGTCTCGC
CTCCGCGCCGCCCCATCCGATGTCGAACCGTCCGATGGCCGTTCGGAGCAGCAGACGTCAGACACGTCGTCCGAC
GACGGGGACTCAGTAGAGGAAGAAGACCCCCAGGACGACGACGAGGGCGATGGCTCCGACGGAGACGACCTGATC
GACGGTGCGATTTCGGAGGACAGCGCGGGAAGCAGTCACGAAGAGGACGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail