Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|360
Gene name
LocationContig_11:41122..42653
Strand+
Gene length (bp)1531
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13506 Glyco_transf_21 Glycosyl transferase family 21 5.6E-12 132 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|I1RPI4|CEGT_GIBZE Ceramide glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GCS1 PE=1 SV=1 1 489 0.0E+00
sp|G4MS28|CEGT_MAGO7 Ceramide glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10668 PE=1 SV=1 1 490 6.0E-171
sp|C4R4B3|CEGT_PICPG Ceramide glucosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0357 PE=1 SV=1 5 481 4.0E-82
sp|Q5AMQ4|CEGT_CANAL Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSX11 PE=1 SV=1 7 481 6.0E-72
sp|J9W453|CEGT_CRYNH Ceramide glucosyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=GCS1 PE=1 SV=1 41 472 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|I1RPI4|CEGT_GIBZE Ceramide glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GCS1 PE=1 SV=1 1 489 0.0E+00
sp|G4MS28|CEGT_MAGO7 Ceramide glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10668 PE=1 SV=1 1 490 6.0E-171
sp|C4R4B3|CEGT_PICPG Ceramide glucosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0357 PE=1 SV=1 5 481 4.0E-82
sp|Q5AMQ4|CEGT_CANAL Ceramide glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSX11 PE=1 SV=1 7 481 6.0E-72
sp|J9W453|CEGT_CRYNH Ceramide glucosyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=GCS1 PE=1 SV=1 41 472 3.0E-53
sp|Q16739|CEGT_HUMAN Ceramide glucosyltransferase OS=Homo sapiens GN=UGCG PE=1 SV=1 51 481 5.0E-28
sp|O88693|CEGT_MOUSE Ceramide glucosyltransferase OS=Mus musculus GN=Ugcg PE=1 SV=1 51 481 1.0E-27
sp|Q9R0E0|CEGT_RAT Ceramide glucosyltransferase OS=Rattus norvegicus GN=Ugcg PE=1 SV=1 51 481 1.0E-27
sp|Q5BL38|CEGT_XENTR Ceramide glucosyltransferase OS=Xenopus tropicalis GN=ugcg PE=2 SV=1 51 481 4.0E-26
sp|Q8AY29|CEGTA_XENLA Ceramide glucosyltransferase-A OS=Xenopus laevis GN=ugcg-a PE=1 SV=1 51 481 5.0E-26
sp|Q5U4S8|CEGTB_XENLA Ceramide glucosyltransferase-B OS=Xenopus laevis GN=ugcg-b PE=2 SV=1 51 481 2.0E-25
sp|O18037|CGT1_CAEEL Ceramide glucosyltransferase 1 OS=Caenorhabditis elegans GN=cgt-1 PE=1 SV=2 9 474 3.0E-21
sp|Q21054|CGT3_CAEEL Ceramide glucosyltransferase 3 OS=Caenorhabditis elegans GN=cgt-3 PE=1 SV=2 1 478 5.0E-21
sp|G5EC84|CGT2_CAEEL Ceramide glucosyltransferase 2 OS=Caenorhabditis elegans GN=cgt-2 PE=1 SV=1 12 483 1.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|360
MLTLIETAALVCLIWSVIVVVVQAVGVVAIYRSFLRRPLPPVSSTLGRDAPVVTIIRPVKGTEPHLYECLASTFQ
QDYPSDKVSIRLCIEDDDDAAYPVLAKVITDFPAFDARILIEKRDPALYGPDAYLSLGPNPKIRNISRAYREAKG
DIIWIVDCNVWVSTGVLGRMVDKLLGYSREGAAKPYKFVHQMPLVVDTIESRPASVKDAASWITRNGGSRLDEMF
MATTHAKFYGSINAVGIAPCIVGKSNMFRKSHLDRVTMASKRRSYIGNTSSGVDYFSHNICEDHLIGELLWRSPM
PGFRNHGLAWGDLVLQPMEGVSVTTYAARRTRWLRARKLTVLAATLVEPGVESMLSCGYLVFALTTLPWLRDRLA
IPPTWTAAGLLWTALMALWMAVDYLTFRMLHSGKATEVDERTPRFARGTSHPDGTKAQSWPVWLLTWMGRETMAF
PIWTWAVLLGTTVSWRGRTFYVNWDNSVEDVTGGEERVKGE*
Coding >Ophun1|360
ATGTTGACCCTGATCGAAACGGCCGCTTTGGTCTGTCTCATCTGGTCCGTCATCGTCGTCGTCGTCCAGGCTGTC
GGCGTTGTCGCCATCTATCGTTCCTTCTTGCGCCGGCCTTTGCCCCCTGTCTCCTCGACGTTGGGACGAGATGCG
CCCGTCGTGACGATAATACGCCCCGTCAAGGGCACCGAGCCTCACCTTTACGAATGTCTGGCGTCCACGTTTCAG
CAGGACTATCCTTCGGACAAGGTGTCGATCCGGTTGTGTATCGAGGACGATGATGACGCTGCCTATCCCGTTCTC
GCCAAGGTCATTACCGATTTCCCCGCCTTCGACGCTCGCATCTTGATAGAGAAGAGGGATCCGGCTCTGTATGGC
CCGGACGCTTACCTCAGTCTGGGCCCGAACCCCAAGATCCGCAATATCAGCAGGGCCTATCGCGAGGCAAAGGGA
GACATCATCTGGATCGTCGACTGCAACGTCTGGGTCTCGACTGGCGTCCTCGGCCGCATGGTGGACAAGCTCCTG
GGCTACAGCCGCGAGGGCGCCGCCAAGCCCTACAAGTTTGTCCACCAGATGCCTCTTGTCGTCGACACAATAGAG
TCGAGGCCAGCTTCGGTTAAAGACGCTGCGTCTTGGATCACTCGTAACGGAGGCAGCCGGCTCGACGAGATGTTC
ATGGCCACGACTCACGCCAAGTTTTACGGGTCCATCAACGCCGTGGGGATCGCTCCCTGCATCGTCGGGAAGAGC
AACATGTTTCGCAAGTCTCATCTAGACCGAGTCACCATGGCTTCAAAGAGGAGGTCTTACATTGGCAACACTTCT
AGCGGCGTCGACTACTTCTCGCATAACATCTGCGAGGACCACCTGATAGGCGAACTCCTATGGCGCTCCCCGATG
CCAGGCTTCCGCAACCACGGACTGGCCTGGGGAGACCTCGTGCTACAGCCCATGGAGGGAGTTTCGGTGACCACG
TACGCAGCTCGTCGAACGCGCTGGCTACGGGCCCGCAAGTTGACGGTGCTGGCGGCGACGCTGGTCGAGCCTGGA
GTCGAGTCCATGCTCTCGTGCGGATACCTGGTATTTGCGCTGACGACGCTGCCCTGGCTTCGCGACCGCTTGGCC
ATCCCGCCTACGTGGACAGCTGCTGGCCTGCTGTGGACGGCGCTGATGGCTCTGTGGATGGCTGTCGACTACCTC
ACCTTTCGCATGTTGCACTCGGGAAAGGCCACCGAAGTCGATGAACGCACGCCGCGTTTCGCGAGAGGCACGTCT
CATCCTGACGGGACGAAGGCGCAGTCGTGGCCCGTCTGGCTGCTGACGTGGATGGGCCGCGAGACGATGGCGTTT
CCCATCTGGACCTGGGCTGTCTTGCTGGGCACGACGGTTAGCTGGAGGGGGAGGACGTTTTACGTCAACTGGGAC
AACTCGGTCGAGGACGTGACTGGAGGTGAGGAGCGGGTCAAGGGGGAGTAG
Transcript >Ophun1|360
ATGTTGACCCTGATCGAAACGGCCGCTTTGGTCTGTCTCATCTGGTCCGTCATCGTCGTCGTCGTCCAGGCTGTC
GGCGTTGTCGCCATCTATCGTTCCTTCTTGCGCCGGCCTTTGCCCCCTGTCTCCTCGACGTTGGGACGAGATGCG
CCCGTCGTGACGATAATACGCCCCGTCAAGGGCACCGAGCCTCACCTTTACGAATGTCTGGCGTCCACGTTTCAG
CAGGACTATCCTTCGGACAAGGTGTCGATCCGGTTGTGTATCGAGGACGATGATGACGCTGCCTATCCCGTTCTC
GCCAAGGTCATTACCGATTTCCCCGCCTTCGACGCTCGCATCTTGATAGAGAAGAGGGATCCGGCTCTGTATGGC
CCGGACGCTTACCTCAGTCTGGGCCCGAACCCCAAGATCCGCAATATCAGCAGGGCCTATCGCGAGGCAAAGGGA
GACATCATCTGGATCGTCGACTGCAACGTCTGGGTCTCGACTGGCGTCCTCGGCCGCATGGTGGACAAGCTCCTG
GGCTACAGCCGCGAGGGCGCCGCCAAGCCCTACAAGTTTGTCCACCAGATGCCTCTTGTCGTCGACACAATAGAG
TCGAGGCCAGCTTCGGTTAAAGACGCTGCGTCTTGGATCACTCGTAACGGAGGCAGCCGGCTCGACGAGATGTTC
ATGGCCACGACTCACGCCAAGTTTTACGGGTCCATCAACGCCGTGGGGATCGCTCCCTGCATCGTCGGGAAGAGC
AACATGTTTCGCAAGTCTCATCTAGACCGAGTCACCATGGCTTCAAAGAGGAGGTCTTACATTGGCAACACTTCT
AGCGGCGTCGACTACTTCTCGCATAACATCTGCGAGGACCACCTGATAGGCGAACTCCTATGGCGCTCCCCGATG
CCAGGCTTCCGCAACCACGGACTGGCCTGGGGAGACCTCGTGCTACAGCCCATGGAGGGAGTTTCGGTGACCACG
TACGCAGCTCGTCGAACGCGCTGGCTACGGGCCCGCAAGTTGACGGTGCTGGCGGCGACGCTGGTCGAGCCTGGA
GTCGAGTCCATGCTCTCGTGCGGATACCTGGTATTTGCGCTGACGACGCTGCCCTGGCTTCGCGACCGCTTGGCC
ATCCCGCCTACGTGGACAGCTGCTGGCCTGCTGTGGACGGCGCTGATGGCTCTGTGGATGGCTGTCGACTACCTC
ACCTTTCGCATGTTGCACTCGGGAAAGGCCACCGAAGTCGATGAACGCACGCCGCGTTTCGCGAGAGGCACGTCT
CATCCTGACGGGACGAAGGCGCAGTCGTGGCCCGTCTGGCTGCTGACGTGGATGGGCCGCGAGACGATGGCGTTT
CCCATCTGGACCTGGGCTGTCTTGCTGGGCACGACGGTTAGCTGGAGGGGGAGGACGTTTTACGTCAACTGGGAC
AACTCGGTCGAGGACGTGACTGGAGGTGAGGAGCGGGTCAAGGGGGAGTAG
Gene >Ophun1|360
ATGTTGACCCTGATCGAAACGGCCGCTTTGGTCTGTCTCATCTGGTCCGTCATCGTCGTCGTCGTCCAGGCTGTC
GGCGTTGTCGCCATGTAAGTCATCATCTTGTCCGTTGCCCTGCCTCGCCTTAGTCTGATGACCTCGCAGCTATCG
TTCCTTCTTGCGCCGGCCTTTGCCCCCTGTCTCCTCGACGTTGGGACGAGATGCGCCCGTCGTGACGATAATACG
CCCCGTCAAGGGCACCGAGCCTCACCTTTACGAATGTCTGGCGTCCACGTTTCAGCAGGACTATCCTTCGGACAA
GGTGTCGATCCGGTTGTGTATCGAGGACGATGATGACGCTGCCTATCCCGTTCTCGCCAAGGTCATTACCGATTT
CCCCGCCTTCGACGCTCGCATCTTGATAGAGAAGAGGGATCCGGCTCTGTATGGCCCGGACGCTTACCTCAGTCT
GGGCCCGAACCCCAAGATCCGCAATATCAGCAGGGCCTATCGCGAGGCAAAGGGAGACATCATCTGGATCGTCGA
CTGCAACGTCTGGGTCTCGACTGGCGTCCTCGGCCGCATGGTGGACAAGCTCCTGGGCTACAGCCGCGAGGGCGC
CGCCAAGCCCTACAAGTTTGTCCACCAGATGCCTCTTGTCGTCGACACAATAGAGTCGAGGCCAGCTTCGGTTAA
AGACGCTGCGTCTTGGATCACTCGTAACGGAGGCAGCCGGCTCGACGAGATGTTCATGGCCACGACTCACGCCAA
GTTTTACGGGTCCATCAACGCCGTGGGGATCGCTCCCTGCATCGTCGGGAAGAGCAACATGTTTCGCAAGTCTCA
TCTAGACCGAGTCACCATGGCTTCAAAGAGGAGGTCTTACATTGGCAACACTTCTAGCGGCGTCGACTACTTCTC
GCATAACATCTGCGAGGACCACCTGATAGGCGAACTCCTATGGCGCTCCCCGATGCCAGGCTTCCGCAACCACGG
ACTGGCCTGGGGAGACCTCGTGCTACAGCCCATGGAGGGAGTTTCGGTGACCACGTACGCAGCTCGTCGAACGCG
CTGGCTACGGGCCCGCAAGTTGACGGTGCTGGCGGCGACGCTGGTCGAGCCTGGAGTCGAGTCCATGCTCTCGTG
CGGATACCTGGTATTTGCGCTGACGACGCTGCCCTGGCTTCGCGACCGCTTGGCCATCCCGCCTACGTGGACAGC
TGCTGGCCTGCTGTGGACGGCGCTGATGGCTCTGTGGATGGCTGTCGACTACCTCACCTTTCGCATGTTGCACTC
GGGAAAGGCCACCGAAGTCGATGAACGCACGCCGCGTTTCGCGAGAGGCACGTCTCATCCTGACGGGACGAAGGC
GCAGTCGTGGCCCGTCTGGCTGCTGACGTGGATGGGCCGCGAGACGATGGCGTTTCCCATCTGGACCTGGGCTGT
CTTGCTGGGCACGACGGTTAGCTGGAGGGGGAGGACGTTTTACGTCAACTGGGACAACTCGGTCGAGGACGTGAC
TGGAGGTGAGGAGCGGGTCAAGGGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail