Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3599
Gene name
LocationContig_32:41965..50453
Strand-
Gene length (bp)8488
Transcript length (bp)5862
Coding sequence length (bp)5862
Protein length (aa) 1954

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 4.2E-22 170 495
PF08442 ATP-grasp_2 ATP-grasp domain 5.8E-21 1575 1759
PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25 1.2E-17 1114 1297
PF00549 Ligase_CoA CoA-ligase 3.2E-17 1819 1932
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 1.0E-05 80 163
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 4.9E-05 1376 1453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K9N6|SUCB_ORYSJ Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0621700 PE=1 SV=1 1573 1936 7.0E-67
sp|Q73FW3|SUCC_WOLPM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis wMel GN=sucC PE=3 SV=1 1577 1941 2.0E-66
sp|B4RCH3|SUCC_PHEZH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Phenylobacterium zucineum (strain HLK1) GN=sucC PE=3 SV=1 1573 1946 4.0E-66
sp|Q5GSB6|SUCC_WOLTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=sucC PE=3 SV=1 1577 1941 8.0E-66
sp|B3CME9|SUCC_WOLPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=sucC PE=3 SV=1 1600 1941 8.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K9N6|SUCB_ORYSJ Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0621700 PE=1 SV=1 1573 1936 7.0E-67
sp|Q73FW3|SUCC_WOLPM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis wMel GN=sucC PE=3 SV=1 1577 1941 2.0E-66
sp|B4RCH3|SUCC_PHEZH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Phenylobacterium zucineum (strain HLK1) GN=sucC PE=3 SV=1 1573 1946 4.0E-66
sp|Q5GSB6|SUCC_WOLTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=sucC PE=3 SV=1 1577 1941 8.0E-66
sp|B3CME9|SUCC_WOLPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=sucC PE=3 SV=1 1600 1941 8.0E-66
sp|B2V8I4|SUCC_SULSY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=sucC PE=3 SV=1 1573 1943 6.0E-65
sp|Q84LB6|SUCB_SOLLC Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 1573 1943 3.0E-64
sp|P53588|SUCB1_CAEEL Probable succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=F47B10.1 PE=3 SV=1 1607 1943 5.0E-64
sp|C0QQH3|SUCC_PERMH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=sucC PE=3 SV=1 1568 1946 7.0E-64
sp|O67546|SUCC_AQUAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aquifex aeolicus (strain VF5) GN=sucC PE=3 SV=1 1568 1943 7.0E-64
sp|Q9AB94|SUCC_CAUCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=sucC PE=3 SV=1 1573 1946 9.0E-64
sp|B8GYZ1|SUCC_CAUCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=sucC PE=3 SV=1 1573 1946 9.0E-64
sp|Q2G3G8|SUCC_NOVAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=sucC PE=3 SV=1 1584 1945 2.0E-63
sp|A9IZV3|SUCC_BART1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=sucC PE=3 SV=1 1582 1946 3.0E-63
sp|A5E936|SUCC_BRASB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=sucC PE=3 SV=1 1586 1946 3.0E-63
sp|A1AZH7|SUCC_PARDP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=sucC PE=3 SV=1 1580 1945 4.0E-63
sp|B4U901|SUCC_HYDS0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=sucC PE=3 SV=1 1573 1944 4.0E-63
sp|Q9P567|SUCB_NEUCR Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B9J10.140 PE=3 SV=1 1609 1944 5.0E-63
sp|A4WNM6|SUCC_RHOS5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=sucC PE=3 SV=1 1580 1945 9.0E-63
sp|A6Q7S7|SUCC_SULNB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=sucC PE=3 SV=1 1563 1932 1.0E-62
sp|C0R4N4|SUCC_WOLWR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=sucC PE=3 SV=1 1575 1941 1.0E-62
sp|Q2GEF1|SUCC_NEOSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neorickettsia sennetsu (strain Miyayama) GN=sucC PE=3 SV=1 1573 1944 2.0E-62
sp|A6WXE8|SUCC_OCHA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=sucC PE=3 SV=1 1582 1945 2.0E-62
sp|Q13UH9|SUCC_BURXL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia xenovorans (strain LB400) GN=sucC PE=3 SV=1 1573 1945 2.0E-62
sp|A4YKC6|SUCC_BRASO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=sucC PE=3 SV=1 1586 1946 2.0E-62
sp|B2UMH5|SUCC_AKKM8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=sucC PE=3 SV=1 1573 1925 2.0E-62
sp|Q6FYD1|SUCC_BARQU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella quintana (strain Toulouse) GN=sucC PE=3 SV=1 1582 1946 4.0E-62
sp|B0T3D1|SUCC_CAUSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter sp. (strain K31) GN=sucC PE=3 SV=1 1573 1946 5.0E-62
sp|P53587|SUCB_NEOFR Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Neocallimastix frontalis GN=SCSB PE=2 SV=2 1577 1943 5.0E-62
sp|B6JE33|SUCC_OLICO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=sucC PE=3 SV=1 1587 1945 6.0E-62
sp|O82662|SUCB_ARATH Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana GN=At2g20420 PE=1 SV=1 1573 1943 9.0E-62
sp|B9KNB3|SUCC_RHOSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=sucC PE=3 SV=1 1580 1945 2.0E-61
sp|Q3IZ84|SUCC_RHOS4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=sucC PE=3 SV=1 1580 1945 2.0E-61
sp|A3PN13|SUCC_RHOS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=sucC PE=3 SV=1 1580 1945 2.0E-61
sp|Q6G1M1|SUCC_BARHE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=sucC PE=3 SV=1 1582 1946 2.0E-61
sp|O97580|SUCB1_PIG Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLA2 PE=2 SV=1 1572 1943 3.0E-61
sp|Q5L0N7|SUCC_GEOKA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=sucC PE=3 SV=1 1573 1944 3.0E-61
sp|C0ZFB3|SUCC_BREBN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=sucC PE=3 SV=1 1573 1944 4.0E-61
sp|A9IKE3|SUCC_BORPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=sucC PE=3 SV=1 1573 1940 6.0E-61
sp|A5EX54|SUCC_DICNV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Dichelobacter nodosus (strain VCS1703A) GN=sucC PE=3 SV=1 1572 1925 1.0E-60
sp|P66868|SUCC_BRUSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis biovar 1 (strain 1330) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|B0CIT0|SUCC_BRUSI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|A5VSQ3|SUCC_BRUO2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|P66867|SUCC_BRUME Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|C0RFH1|SUCC_BRUMB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|A9M8R2|SUCC_BRUC2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|Q57AX2|SUCC_BRUAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus biovar 1 (strain 9-941) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|B2S880|SUCC_BRUA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus (strain S19) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|A4XV90|SUCC_PSEMY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas mendocina (strain ymp) GN=sucC PE=3 SV=1 1582 1945 1.0E-60
sp|B2SYE8|SUCC_BURPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=sucC PE=3 SV=1 1573 1925 1.0E-60
sp|Q21CW8|SUCC_RHOPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=sucC PE=3 SV=1 1587 1946 1.0E-60
sp|Q89X60|SUCC_BRADU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=sucC PE=3 SV=1 1650 1946 2.0E-60
sp|B3Q760|SUCC_RHOPT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=sucC PE=3 SV=1 1594 1946 2.0E-60
sp|Q6NDB7|SUCC_RHOPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=sucC PE=3 SV=1 1594 1946 2.0E-60
sp|Q2T0U7|SUCC_BURTA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=sucC PE=3 SV=1 1573 1925 3.0E-60
sp|B5EMG2|SUCC_ACIF5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=sucC PE=3 SV=1 1573 1925 3.0E-60
sp|B7J4G8|SUCC_ACIF2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=sucC PE=3 SV=1 1573 1925 3.0E-60
sp|Q9P2R7|SUCB1_HUMAN Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLA2 PE=1 SV=3 1572 1944 5.0E-60
sp|Q13DR5|SUCC_RHOPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=sucC PE=3 SV=1 1594 1925 1.0E-59
sp|Q5WFP4|SUCC_BACSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus clausii (strain KSM-K16) GN=sucC PE=3 SV=1 1573 1942 1.0E-59
sp|A7GYI5|SUCC_CAMC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter curvus (strain 525.92) GN=sucC PE=3 SV=1 1600 1945 1.0E-59
sp|A1UQV9|SUCC_BARBK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=sucC PE=3 SV=1 1582 1946 1.0E-59
sp|Q475M1|SUCC_CUPPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=sucC PE=3 SV=1 1577 1925 2.0E-59
sp|Q21RF9|SUCC_RHOFT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=sucC PE=3 SV=1 1572 1925 2.0E-59
sp|Q9PAH1|SUCC_XYLFA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain 9a5c) GN=sucC PE=3 SV=1 1563 1925 2.0E-59
sp|Q9Z2I9|SUCB1_MOUSE Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Sucla2 PE=1 SV=2 1572 1944 2.0E-59
sp|Q2S3H9|SUCC_SALRD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salinibacter ruber (strain DSM 13855 / M31) GN=sucC PE=3 SV=1 1573 1929 2.0E-59
sp|Q1H031|SUCC_METFK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=sucC PE=3 SV=1 1611 1925 2.0E-59
sp|Q869S7|SUCB2_DICDI Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsB PE=3 SV=1 1573 1939 2.0E-59
sp|B3E7B3|SUCC_GEOLS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=sucC PE=3 SV=1 1573 1927 2.0E-59
sp|B0BTV5|SUCC_ACTPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=sucC PE=3 SV=1 1563 1945 3.0E-59
sp|Q4R517|SUCB1_MACFA Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Macaca fascicularis GN=SUCLA2 PE=2 SV=1 1572 1944 3.0E-59
sp|Q2J3G9|SUCC_RHOP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=sucC PE=3 SV=1 1587 1946 3.0E-59
sp|A1VYP2|SUCC_CAMJJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=sucC PE=3 SV=1 1563 1923 4.0E-59
sp|A6TKJ3|SUCC_ALKMQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=sucC PE=3 SV=1 1573 1945 4.0E-59
sp|Q07UX6|SUCC_RHOP5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=sucC PE=3 SV=1 1650 1946 5.0E-59
sp|Q0AKU3|SUCC_MARMM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Maricaulis maris (strain MCS10) GN=sucC PE=3 SV=1 1666 1925 5.0E-59
sp|B2AHC1|SUCC_CUPTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=sucC PE=3 SV=1 1576 1925 6.0E-59
sp|Q55AI5|SUCB1_DICDI Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsC PE=3 SV=1 1607 1950 7.0E-59
sp|A0KA72|SUCC_BURCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain HI2424) GN=sucC PE=3 SV=1 1573 1925 8.0E-59
sp|B1JY14|SUCC_BURCC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain MC0-3) GN=sucC PE=3 SV=1 1573 1925 8.0E-59
sp|Q1BTW6|SUCC_BURCA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=sucC PE=3 SV=1 1573 1925 8.0E-59
sp|Q28U74|SUCC_JANSC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Jannaschia sp. (strain CCS1) GN=sucC PE=3 SV=1 1580 1945 8.0E-59
sp|P53312|SUCB_YEAST Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSC2 PE=1 SV=1 1609 1944 9.0E-59
sp|A6SUY3|SUCC_JANMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Janthinobacterium sp. (strain Marseille) GN=sucC PE=3 SV=1 1573 1945 9.0E-59
sp|Q39D96|SUCC_BURL3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=sucC PE=3 SV=1 1573 1925 9.0E-59
sp|B4EBY6|SUCC_BURCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|Q11CV8|SUCC_CHESB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chelativorans sp. (strain BNC1) GN=sucC PE=3 SV=1 1587 1940 1.0E-58
sp|Q63WW2|SUCC_BURPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain K96243) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A3N693|SUCC_BURP6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 668) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|Q3JVL5|SUCC_BURP1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1710b) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A3NRX7|SUCC_BURP0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1106a) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A1V6W8|SUCC_BURMS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain SAVP1) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|Q62MG7|SUCC_BURMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain ATCC 23344) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A2S8U3|SUCC_BURM9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A3MH60|SUCC_BURM7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10247) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|Q0BC71|SUCC_BURCM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|B1YVY6|SUCC_BURA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain MC40-6) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|C5D8V2|SUCC_GEOSW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus sp. (strain WCH70) GN=sucC PE=3 SV=1 1573 1944 1.0E-58
sp|A3MZH0|SUCC_ACTP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=sucC PE=3 SV=1 1563 1945 1.0E-58
sp|B3QWF8|SUCC_CHLT3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=sucC PE=3 SV=1 1573 1925 1.0E-58
sp|A1WD26|SUCC_ACISJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax sp. (strain JS42) GN=sucC PE=3 SV=1 1573 1944 1.0E-58
sp|B9MHW0|SUCC_ACIET Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax ebreus (strain TPSY) GN=sucC PE=3 SV=1 1573 1944 1.0E-58
sp|A8FKV6|SUCC_CAMJ8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=sucC PE=3 SV=1 1563 1923 2.0E-58
sp|Q1QQR3|SUCC_NITHX Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=sucC PE=3 SV=1 1609 1945 2.0E-58
sp|Q4KFY6|SUCC_PSEF5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sucC PE=3 SV=1 1582 1945 2.0E-58
sp|A4IM83|SUCC_GEOTN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=sucC PE=3 SV=1 1573 1944 3.0E-58
sp|Q6GHJ0|SUCC_STAAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=sucC PE=3 SV=1 1573 1946 3.0E-58
sp|Q48K68|SUCC_PSE14 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sucC PE=3 SV=1 1611 1945 3.0E-58
sp|A4G230|SUCC_HERAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herminiimonas arsenicoxydans GN=sucC PE=3 SV=1 1573 1945 3.0E-58
sp|C3K6N0|SUCC_PSEFS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain SBW25) GN=sucC PE=3 SV=1 1611 1945 3.0E-58
sp|P66872|SUCC_STAAW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MW2) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|A8Z3S5|SUCC_STAAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|Q6G9W8|SUCC_STAAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|P99071|SUCC_STAAN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain N315) GN=sucC PE=1 SV=1 1573 1946 4.0E-58
sp|P66871|SUCC_STAAM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|A6QGE5|SUCC_STAAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Newman) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|Q5HGI7|SUCC_STAAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain COL) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|A5ISD0|SUCC_STAA9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH9) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|Q2FZ37|SUCC_STAA8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|Q2FHJ3|SUCC_STAA3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|A6U164|SUCC_STAA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH1) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|A7X1L8|SUCC_STAA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sucC PE=3 SV=1 1573 1946 4.0E-58
sp|B3EFL3|SUCC_CHLL2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=sucC PE=3 SV=1 1573 1925 4.0E-58
sp|Q02K73|SUCC_PSEAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sucC PE=3 SV=1 1582 1945 4.0E-58
sp|Q2N695|SUCC_ERYLH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Erythrobacter litoralis (strain HTCC2594) GN=sucC PE=3 SV=1 1584 1946 4.0E-58
sp|Q0I3A8|SUCC_HAES1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus somnus (strain 129Pt) GN=sucC PE=3 SV=1 1568 1947 4.0E-58
sp|Q3KFU6|SUCC_PSEPF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas fluorescens (strain Pf0-1) GN=sucC PE=3 SV=1 1611 1945 5.0E-58
sp|B9L5I6|SUCC_NAUPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=sucC PE=3 SV=1 1573 1923 5.0E-58
sp|Q148D5|SUCB1_BOVIN Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLA2 PE=2 SV=1 1572 1944 5.0E-58
sp|Q15UW6|SUCC_PSEA6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=sucC PE=3 SV=1 1556 1946 6.0E-58
sp|P53593|SUCC_PSEAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucC PE=3 SV=2 1582 1945 6.0E-58
sp|B7UVD3|SUCC_PSEA8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain LESB58) GN=sucC PE=3 SV=1 1582 1945 6.0E-58
sp|Q03184|SUCB_TRIVA Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Trichomonas vaginalis PE=1 SV=1 1584 1945 6.0E-58
sp|Q4ZUW7|SUCC_PSEU2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sucC PE=3 SV=1 1611 1945 7.0E-58
sp|A6UDP2|SUCC_SINMW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=sucC PE=3 SV=1 1584 1946 7.0E-58
sp|Q883Z4|SUCC_PSESM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sucC PE=3 SV=1 1611 1945 7.0E-58
sp|A8EYY8|SUCC_RICCK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia canadensis (strain McKiel) GN=sucC PE=3 SV=1 1573 1941 9.0E-58
sp|Q2RV33|SUCC_RHORT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=sucC PE=3 SV=1 1584 1946 9.0E-58
sp|B9JCF4|SUCC_AGRRK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=sucC PE=3 SV=1 1584 1945 1.0E-57
sp|B0UUF3|SUCC_HISS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Histophilus somni (strain 2336) GN=sucC PE=3 SV=1 1568 1947 1.0E-57
sp|A6V7K5|SUCC_PSEA7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas aeruginosa (strain PA7) GN=sucC PE=3 SV=1 1582 1945 1.0E-57
sp|Q255N7|SUCC_CHLFF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila felis (strain Fe/C-56) GN=sucC PE=3 SV=1 1577 1921 1.0E-57
sp|Q5HVN3|SUCC_CAMJR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni (strain RM1221) GN=sucC PE=3 SV=1 1573 1923 1.0E-57
sp|Q9PHY1|SUCC_CAMJE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=sucC PE=3 SV=1 1573 1923 1.0E-57
sp|B4RL77|SUCC_NEIG2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria gonorrhoeae (strain NCCP11945) GN=sucC PE=3 SV=1 1586 1925 1.0E-57
sp|A7H4K9|SUCC_CAMJD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=sucC PE=3 SV=1 1563 1923 1.0E-57
sp|Q1MAW1|SUCC_RHIL3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=sucC PE=3 SV=1 1585 1925 2.0E-57
sp|A0RPE8|SUCC_CAMFF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=sucC PE=3 SV=1 1581 1943 2.0E-57
sp|Q5F878|SUCC_NEIG1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=sucC PE=3 SV=1 1586 1925 2.0E-57
sp|Q2K3F0|SUCC_RHIEC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=sucC PE=3 SV=1 1600 1925 2.0E-57
sp|Q2YXM1|SUCC_STAAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sucC PE=3 SV=1 1573 1946 3.0E-57
sp|Q8CPH5|SUCC_STAES Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucC PE=3 SV=1 1573 1946 3.0E-57
sp|Q5HPU5|SUCC_STAEQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucC PE=3 SV=1 1573 1946 3.0E-57
sp|Q4FP29|SUCC_PELUB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelagibacter ubique (strain HTCC1062) GN=sucC PE=3 SV=1 1573 1941 3.0E-57
sp|Q0KE75|SUCC_CUPNH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucC PE=3 SV=1 1576 1925 3.0E-57
sp|B8FLW6|SUCC_DESAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=sucC PE=3 SV=1 1563 1925 3.0E-57
sp|Q7VVU5|SUCC_BORPE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=sucC PE=3 SV=1 1573 1940 5.0E-57
sp|Q7W789|SUCC_BORPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=sucC PE=3 SV=1 1573 1940 5.0E-57
sp|Q7WKM5|SUCC_BORBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=sucC PE=3 SV=1 1573 1940 5.0E-57
sp|B9DPG0|SUCC_STACT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus carnosus (strain TM300) GN=sucC PE=3 SV=1 1573 1944 5.0E-57
sp|A5UCR4|SUCC_HAEIE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain PittEE) GN=sucC PE=3 SV=1 1611 1945 5.0E-57
sp|B0U5F8|SUCC_XYLFM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain M12) GN=sucC PE=3 SV=1 1563 1925 5.0E-57
sp|A7HT39|SUCC_PARL1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=sucC PE=3 SV=1 1563 1946 6.0E-57
sp|Q87A98|SUCC_XYLFT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=sucC PE=3 SV=1 1563 1925 7.0E-57
sp|B2I9R4|SUCC_XYLF2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xylella fastidiosa (strain M23) GN=sucC PE=3 SV=1 1563 1925 7.0E-57
sp|B5ZSR9|SUCC_RHILW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=sucC PE=3 SV=1 1600 1925 7.0E-57
sp|Q9EYG9|SUCC_RHIME Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium meliloti (strain 1021) GN=sucC PE=3 SV=1 1606 1946 8.0E-57
sp|B3GX29|SUCC_ACTP7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=sucC PE=3 SV=1 1666 1945 9.0E-57
sp|Q9JUT0|SUCC_NEIMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=sucC PE=3 SV=1 1586 1925 1.0E-56
sp|A9AFT3|SUCC_BURM1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=sucC PE=3 SV=1 1573 1925 1.0E-56
sp|P53594|MTKA_METEA Malate--CoA ligase subunit beta OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mtkA PE=3 SV=2 1573 1947 1.0E-56
sp|Q4L5U8|SUCC_STAHJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sucC PE=3 SV=1 1573 1946 1.0E-56
sp|A9M4F8|SUCC_NEIM0 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup C (strain 053442) GN=sucC PE=3 SV=1 1586 1925 1.0E-56
sp|P45101|SUCC_HAEIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucC PE=3 SV=1 1611 1945 1.0E-56
sp|A9BQA5|SUCC_DELAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=sucC PE=3 SV=1 1573 1944 2.0E-56
sp|B9JTS8|SUCC_AGRVS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=sucC PE=3 SV=1 1584 1946 2.0E-56
sp|Q6MBM7|SUCC_PARUW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=sucC PE=3 SV=1 1573 1925 2.0E-56
sp|Q9KA20|SUCC_BACHD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=sucC PE=3 SV=1 1573 1944 2.0E-56
sp|Q9JZP4|SUCC_NEIMB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup B (strain MC58) GN=sucC PE=3 SV=1 1586 1925 2.0E-56
sp|B3PQ90|SUCC_RHIE6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium etli (strain CIAT 652) GN=sucC PE=3 SV=1 1600 1925 2.0E-56
sp|A4JHJ8|SUCC_BURVG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=sucC PE=3 SV=1 1573 1925 2.0E-56
sp|A7I2F2|SUCC_CAMHC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=sucC PE=3 SV=1 1584 1945 3.0E-56
sp|Q8UC60|SUCC_AGRFC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sucC PE=3 SV=1 1585 1925 3.0E-56
sp|Q49X32|SUCC_STAS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sucC PE=3 SV=1 1573 1946 3.0E-56
sp|Q5P7A7|SUCC_AROAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Aromatoleum aromaticum (strain EbN1) GN=sucC PE=3 SV=1 1573 1940 3.0E-56
sp|A1KTM6|SUCC_NEIMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=sucC PE=3 SV=1 1586 1925 3.0E-56
sp|A1KAU3|SUCC_AZOSB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azoarcus sp. (strain BH72) GN=sucC PE=3 SV=1 1573 1940 3.0E-56
sp|A5VB78|SUCC_SPHWW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=sucC PE=3 SV=1 1573 1946 4.0E-56
sp|Q9YI37|SUCB1_COLLI Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Columba livia GN=SUCLA2 PE=1 SV=1 1572 1944 4.0E-56
sp|Q3B5J6|SUCC_CHLL7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=sucC PE=3 SV=1 1573 1925 4.0E-56
sp|Q2KYF7|SUCC_BORA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella avium (strain 197N) GN=sucC PE=3 SV=1 1573 1925 4.0E-56
sp|B1YIL7|SUCC_EXIS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=sucC PE=3 SV=1 1584 1925 4.0E-56
sp|C4L610|SUCC_EXISA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=sucC PE=3 SV=1 1611 1944 5.0E-56
sp|P80886|SUCC_BACSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis (strain 168) GN=sucC PE=1 SV=2 1573 1942 5.0E-56
sp|B4SEH6|SUCC_PELPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=sucC PE=3 SV=1 1573 1946 5.0E-56
sp|Q5QU21|SUCC_IDILO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=sucC PE=3 SV=1 1584 1925 6.0E-56
sp|A4SDL6|SUCC_CHLPM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=sucC PE=3 SV=1 1573 1941 7.0E-56
sp|B2UGE2|SUCC_RALPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia pickettii (strain 12J) GN=sucC PE=3 SV=1 1576 1925 9.0E-56
sp|A5UIW0|SUCC_HAEIG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain PittGG) GN=sucC PE=3 SV=1 1611 1950 9.0E-56
sp|Q9CNZ0|SUCC_PASMU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pasteurella multocida (strain Pm70) GN=sucC PE=3 SV=1 1584 1945 1.0E-55
sp|Q8F746|SUCC_LEPIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=sucC PE=3 SV=1 1665 1940 1.0E-55
sp|Q72PA2|SUCC_LEPIC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=sucC PE=3 SV=1 1665 1940 1.0E-55
sp|Q98EC5|SUCC_RHILO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium loti (strain MAFF303099) GN=sucC PE=3 SV=1 1600 1945 1.0E-55
sp|Q5WZ04|SUCC_LEGPL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Lens) GN=sucC PE=3 SV=1 1611 1940 1.0E-55
sp|A5IH21|SUCC_LEGPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Corby) GN=sucC PE=3 SV=1 1611 1940 1.0E-55
sp|Q3ATR4|SUCC_CHLCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=sucC PE=3 SV=1 1573 1925 1.0E-55
sp|Q5X7K6|SUCC_LEGPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Legionella pneumophila (strain Paris) GN=sucC PE=3 SV=1 1611 1940 1.0E-55
sp|B9EBC7|SUCC_MACCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=sucC PE=3 SV=1 1573 1947 1.0E-55
sp|B1XRZ4|SUCC_POLNS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=sucC PE=3 SV=1 1584 1925 1.0E-55
sp|A1TW81|SUCC_ACIAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax citrulli (strain AAC00-1) GN=sucC PE=3 SV=1 1573 1940 1.0E-55
sp|Q822A1|SUCC_CHLCV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila caviae (strain GPIC) GN=sucC PE=3 SV=1 1577 1921 1.0E-55
sp|B9LB77|SUCC_CHLSY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=sucC PE=3 SV=1 1587 1945 2.0E-55
sp|A9WJ74|SUCC_CHLAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=sucC PE=3 SV=1 1587 1945 2.0E-55
sp|Q122H7|SUCC_POLSJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=sucC PE=3 SV=1 1573 1940 2.0E-55
sp|Q81WK0|SUCC_BACAN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|C3L791|SUCC_BACAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|C3P5N7|SUCC_BACAA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain A0248) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|Q6MGW1|SUCC_BDEBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=sucC PE=3 SV=1 1665 1945 3.0E-55
sp|Q6HEX9|SUCC_BACHK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|Q636J0|SUCC_BACCZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|B9IVC5|SUCC_BACCQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain Q1) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|B7HLG9|SUCC_BACC7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain AH187) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|C1EP60|SUCC_BACC3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain 03BB102) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|Q732N4|SUCC_BACC1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|A0RHK9|SUCC_BACAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=sucC PE=3 SV=1 1573 1942 3.0E-55
sp|C0QLM0|SUCC_DESAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=sucC PE=3 SV=1 1666 1925 4.0E-55
sp|A4SZY0|SUCC_POLSQ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=sucC PE=3 SV=1 1584 1925 4.0E-55
sp|B8GN38|SUCC_THISH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=sucC PE=3 SV=1 1664 1940 4.0E-55
sp|Q4QLA3|SUCC_HAEI8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus influenzae (strain 86-028NP) GN=sucC PE=3 SV=1 1611 1945 4.0E-55
sp|A6Q391|SUCC_NITSB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=sucC PE=3 SV=1 1573 1945 5.0E-55
sp|A8MM16|SUCC_ALKOO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=sucC PE=3 SV=1 1573 1944 5.0E-55
sp|B6IP72|SUCC_RHOCS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=sucC PE=3 SV=1 1573 1946 6.0E-55
sp|Q8KFE7|SUCC_CHLTE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=sucC PE=3 SV=1 1573 1925 7.0E-55
sp|A8FD73|SUCC_BACP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=sucC PE=3 SV=1 1573 1944 9.0E-55
sp|Q053V6|SUCC_LEPBL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=sucC PE=3 SV=1 1665 1940 9.0E-55
sp|Q04QS3|SUCC_LEPBJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=sucC PE=3 SV=1 1665 1940 9.0E-55
sp|Q0C5F3|SUCC_HYPNA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hyphomonas neptunium (strain ATCC 15444) GN=sucC PE=3 SV=1 1650 1945 1.0E-54
sp|Q3SVK4|SUCC_NITWN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=sucC PE=3 SV=1 1609 1925 1.0E-54
sp|B3CTW0|SUCC_ORITI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Orientia tsutsugamushi (strain Ikeda) GN=sucC PE=3 SV=1 1666 1941 1.0E-54
sp|A7GRG6|SUCC_BACCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=sucC PE=3 SV=1 1573 1942 1.0E-54
sp|C1F2F2|SUCC_ACIC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=sucC PE=3 SV=1 1573 1924 1.0E-54
sp|A9VT74|SUCC_BACWK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=sucC PE=3 SV=1 1573 1942 1.0E-54
sp|Q8Y1Y3|SUCC_RALSO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia solanacearum (strain GMI1000) GN=sucC PE=3 SV=1 1650 1925 2.0E-54
sp|A7Z4M9|SUCC_BACMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=sucC PE=3 SV=1 1573 1942 2.0E-54
sp|Q30RQ3|SUCC_SULDN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=sucC PE=3 SV=1 1563 1923 2.0E-54
sp|A1BE51|SUCC_CHLPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=sucC PE=3 SV=1 1573 1941 2.0E-54
sp|B3EN95|SUCC_CHLPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain BS1) GN=sucC PE=3 SV=1 1573 1925 3.0E-54
sp|Q65JP0|SUCC_BACLD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=sucC PE=3 SV=1 1573 1944 3.0E-54
sp|A5FYZ9|SUCC_ACICJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidiphilium cryptum (strain JF-5) GN=sucC PE=3 SV=1 1666 1946 3.0E-54
sp|B7IUJ5|SUCC_BACC2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain G9842) GN=sucC PE=3 SV=1 1573 1942 3.0E-54
sp|C5BL83|SUCC_TERTT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=sucC PE=3 SV=1 1611 1945 3.0E-54
sp|Q74EA5|SUCC_GEOSL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sucC PE=3 SV=1 1563 1940 3.0E-54
sp|B8F4Q2|SUCC_HAEPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=sucC PE=3 SV=1 1568 1925 3.0E-54
sp|B7HDV9|SUCC_BACC4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain B4264) GN=sucC PE=3 SV=1 1573 1942 3.0E-54
sp|Q47AN8|SUCC_DECAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Dechloromonas aromatica (strain RCB) GN=sucC PE=3 SV=1 1573 1940 3.0E-54
sp|A7NNW3|SUCC_ROSCS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=sucC PE=3 SV=1 1613 1946 4.0E-54
sp|Q819X0|SUCC_BACCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=sucC PE=3 SV=1 1573 1942 4.0E-54
sp|O94415|SUCB_SCHPO Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.08 PE=3 SV=1 1573 1947 4.0E-54
sp|Q5NHF3|SUCC_FRATT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=sucC PE=3 SV=1 1586 1925 5.0E-54
sp|Q14IV5|SUCC_FRAT1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=sucC PE=3 SV=1 1586 1925 5.0E-54
sp|B3QPP2|SUCC_CHLP8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobaculum parvum (strain NCIB 8327) GN=sucC PE=3 SV=1 1611 1925 5.0E-54
sp|A5CC52|SUCC_ORITB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Orientia tsutsugamushi (strain Boryong) GN=sucC PE=3 SV=1 1666 1941 6.0E-54
sp|A1AVI3|SUCC_RUTMC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ruthia magnifica subsp. Calyptogena magnifica GN=sucC PE=3 SV=1 1625 1944 6.0E-54
sp|A0Q5H4|SUCC_FRATN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. novicida (strain U112) GN=sucC PE=3 SV=1 1586 1925 8.0E-54
sp|B4S612|SUCC_PROA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=sucC PE=3 SV=1 1573 1925 8.0E-54
sp|Q2W063|SUCC_MAGSA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=sucC PE=3 SV=1 1586 1946 8.0E-54
sp|Q2A253|SUCC_FRATH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain LVS) GN=sucC PE=3 SV=1 1586 1925 9.0E-54
sp|A7NDR1|SUCC_FRATF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=sucC PE=3 SV=1 1586 1925 9.0E-54
sp|Q1D6I9|SUCC_MYXXD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Myxococcus xanthus (strain DK 1622) GN=sucC PE=3 SV=1 1573 1925 1.0E-53
sp|B1ZP17|SUCC_OPITP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=sucC PE=3 SV=1 1660 1942 1.0E-53
sp|Q0BKS4|SUCC_FRATO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=sucC PE=3 SV=1 1586 1925 1.0E-53
sp|B2SDM1|SUCC_FRATM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=sucC PE=3 SV=1 1586 1925 1.0E-53
sp|Q0A5K0|SUCC_ALKEH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=sucC PE=3 SV=1 1577 1940 1.0E-53
sp|A5V080|SUCC_ROSS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Roseiflexus sp. (strain RS-1) GN=sucC PE=3 SV=1 1613 1923 2.0E-53
sp|B0TZ23|SUCC_FRAP2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=sucC PE=3 SV=1 1586 1925 2.0E-53
sp|A4IZC2|SUCC_FRATW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=sucC PE=3 SV=1 1586 1925 3.0E-53
sp|A8A8L8|SUCC_IGNH4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=sucC PE=3 SV=1 1559 1946 4.0E-53
sp|A1APQ8|SUCC_PELPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelobacter propionicus (strain DSM 2379) GN=sucC PE=3 SV=1 1573 1925 4.0E-53
sp|A9GD65|SUCC_SORC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sorangium cellulosum (strain So ce56) GN=sucC PE=3 SV=1 1628 1948 4.0E-53
sp|Q88FB2|SUCC_PSEPK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain KT2440) GN=sucC PE=3 SV=1 1611 1945 4.0E-53
sp|A5W114|SUCC_PSEP1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sucC PE=3 SV=1 1611 1945 4.0E-53
sp|B1JAV3|SUCC_PSEPW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain W619) GN=sucC PE=3 SV=1 1611 1945 5.0E-53
sp|Q1I7L3|SUCC_PSEE4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas entomophila (strain L48) GN=sucC PE=3 SV=1 1611 1945 5.0E-53
sp|A8ZRW7|SUCC_DESOH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=sucC PE=3 SV=1 1621 1925 5.0E-53
sp|P53589|SUCB2_CAEEL Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=sucg-1 PE=3 SV=1 1631 1944 5.0E-53
sp|Q3SKM1|SUCC_THIDA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thiobacillus denitrificans (strain ATCC 25259) GN=sucC PE=3 SV=1 1576 1943 8.0E-53
sp|Q7M9A6|SUCC_WOLSU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=sucC PE=3 SV=1 1565 1943 8.0E-53
sp|Q6F8L4|SUCC_ACIAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=sucC PE=3 SV=1 1581 1945 9.0E-53
sp|A8F1K7|SUCC_RICM5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia massiliae (strain Mtu5) GN=sucC PE=3 SV=1 1573 1944 1.0E-52
sp|A5WC33|SUCC_PSYWF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter sp. (strain PRwf-1) GN=sucC PE=3 SV=1 1611 1946 1.0E-52
sp|Q5H2H4|SUCC_XANOR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=sucC PE=3 SV=1 1573 1946 1.0E-52
sp|B2ST87|SUCC_XANOP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=sucC PE=3 SV=1 1573 1946 1.0E-52
sp|Q2P5E6|SUCC_XANOM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=sucC PE=3 SV=1 1573 1946 1.0E-52
sp|Q65SV1|SUCC_MANSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mannheimia succiniciproducens (strain MBEL55E) GN=sucC PE=3 SV=1 1584 1945 1.0E-52
sp|Q5L593|SUCC_CHLAB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=sucC PE=3 SV=1 1577 1919 2.0E-52
sp|Q5NMF5|SUCC_ZYMMO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=sucC PE=3 SV=1 1581 1944 2.0E-52
sp|B0KNW8|SUCC_PSEPG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain GB-1) GN=sucC PE=3 SV=1 1611 1945 2.0E-52
sp|A4VKQ1|SUCC_PSEU5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas stutzeri (strain A1501) GN=sucC PE=3 SV=1 1611 1945 2.0E-52
sp|B0BAS9|SUCC_CHLTB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=sucC PE=3 SV=1 1631 1944 2.0E-52
sp|B0B950|SUCC_CHLT2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=sucC PE=3 SV=1 1631 1944 2.0E-52
sp|C1DB55|SUCC_LARHH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Laribacter hongkongensis (strain HLHK9) GN=sucC PE=3 SV=1 1601 1925 2.0E-52
sp|Q5HC25|SUCC_EHRRW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia ruminantium (strain Welgevonden) GN=sucC PE=3 SV=1 1573 1925 2.0E-52
sp|Q021N6|SUCC_SOLUE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=sucC PE=3 SV=1 1649 1943 2.0E-52
sp|B4RYG2|SUCC_ALTMD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=sucC PE=3 SV=1 1611 1945 2.0E-52
sp|Q5FH54|SUCC_EHRRG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia ruminantium (strain Gardel) GN=sucC PE=3 SV=1 1573 1925 3.0E-52
sp|C1A8X8|SUCC_GEMAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=sucC PE=3 SV=1 1572 1943 3.0E-52
sp|B0VSL0|SUCC_ACIBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain SDF) GN=sucC PE=3 SV=1 1581 1925 3.0E-52
sp|B0VEF2|SUCC_ACIBY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AYE) GN=sucC PE=3 SV=1 1581 1925 3.0E-52
sp|A3M887|SUCC_ACIBT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=sucC PE=3 SV=2 1581 1925 3.0E-52
sp|B2HXG0|SUCC_ACIBC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain ACICU) GN=sucC PE=3 SV=1 1581 1925 3.0E-52
sp|B7I6T2|SUCC_ACIB5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AB0057) GN=sucC PE=3 SV=1 1581 1925 3.0E-52
sp|B7GXK7|SUCC_ACIB3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acinetobacter baumannii (strain AB307-0294) GN=sucC PE=3 SV=1 1581 1925 3.0E-52
sp|C3LP35|SUCC_VIBCM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sucC PE=3 SV=1 1611 1945 3.0E-52
sp|Q9KQB5|SUCC_VIBCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sucC PE=3 SV=1 1611 1945 3.0E-52
sp|A5F6G6|SUCC_VIBC3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sucC PE=3 SV=1 1611 1945 3.0E-52
sp|Q2GFL7|SUCC_EHRCR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=sucC PE=3 SV=1 1573 1944 3.0E-52
sp|A0LZD4|SUCC_GRAFK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Gramella forsetii (strain KT0803) GN=sucC PE=3 SV=1 1621 1942 3.0E-52
sp|O84828|SUCC_CHLTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=sucC PE=3 SV=1 1631 1944 4.0E-52
sp|Q3KKL8|SUCC_CHLTA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=sucC PE=3 SV=1 1631 1944 4.0E-52
sp|C1DM53|SUCC_AZOVD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sucC PE=3 SV=1 1611 1925 4.0E-52
sp|C4K7D7|SUCC_HAMD5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sucC PE=3 SV=1 1563 1939 4.0E-52
sp|Q2IIC1|SUCC_ANADE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=sucC PE=3 SV=1 1652 1946 5.0E-52
sp|A8GS29|SUCC_RICRS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Sheila Smith) GN=sucC PE=3 SV=1 1573 1944 6.0E-52
sp|B0BXJ5|SUCC_RICRO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Iowa) GN=sucC PE=3 SV=1 1573 1944 6.0E-52
sp|Q3YSV6|SUCC_EHRCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ehrlichia canis (strain Jake) GN=sucC PE=3 SV=1 1573 1925 6.0E-52
sp|Q1IJS5|SUCC_KORVE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Koribacter versatilis (strain Ellin345) GN=sucC PE=3 SV=1 1573 1924 6.0E-52
sp|A9L532|SUCC_SHEB9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS195) GN=sucC PE=3 SV=1 1666 1945 6.0E-52
sp|A6WPA4|SUCC_SHEB8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS185) GN=sucC PE=3 SV=1 1666 1945 6.0E-52
sp|A3D5J3|SUCC_SHEB5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=sucC PE=3 SV=1 1666 1945 6.0E-52
sp|B8E770|SUCC_SHEB2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella baltica (strain OS223) GN=sucC PE=3 SV=1 1666 1945 6.0E-52
sp|A6T6F6|SUCC_KLEP7 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sucC PE=3 SV=1 1556 1945 6.0E-52
sp|B5XZD1|SUCC_KLEP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Klebsiella pneumoniae (strain 342) GN=sucC PE=3 SV=1 1556 1945 6.0E-52
sp|Q7NZ47|SUCC_CHRVO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=sucC PE=3 SV=1 1581 1925 6.0E-52
sp|B4UDP4|SUCC_ANASK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter sp. (strain K) GN=sucC PE=3 SV=1 1652 1946 7.0E-52
sp|B8JAE0|SUCC_ANAD2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=sucC PE=3 SV=1 1652 1946 7.0E-52
sp|Q080X8|SUCC_SHEFN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella frigidimarina (strain NCIMB 400) GN=sucC PE=3 SV=1 1666 1945 9.0E-52
sp|A9B0I2|SUCC_HERA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=sucC PE=3 SV=1 1581 1944 9.0E-52
sp|Q8PHL5|SUCC_XANAC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas axonopodis pv. citri (strain 306) GN=sucC PE=3 SV=1 1573 1946 9.0E-52
sp|A1JRB6|SUCC_YERE8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sucC PE=3 SV=1 1575 1940 9.0E-52
sp|A1VUC0|SUCC_POLNA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas naphthalenivorans (strain CJ2) GN=sucC PE=3 SV=1 1573 1940 9.0E-52
sp|Q3BQ83|SUCC_XANC5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=sucC PE=3 SV=1 1573 1946 1.0E-51
sp|Q92I21|SUCC_RICCN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucC PE=3 SV=1 1665 1944 1.0E-51
sp|B5FNF9|SUCC_SALDC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella dublin (strain CT_02021853) GN=sucC PE=3 SV=1 1556 1945 1.0E-51
sp|C4K0K1|SUCC_RICPU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia peacockii (strain Rustic) GN=sucC PE=3 SV=1 1573 1944 1.0E-51
sp|A1WZ92|SUCC_HALHL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=sucC PE=3 SV=1 1611 1925 2.0E-51
sp|A1RIT3|SUCC_SHESW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain W3-18-1) GN=sucC PE=3 SV=1 1666 1945 2.0E-51
sp|A4Y7Q5|SUCC_SHEPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=sucC PE=3 SV=1 1666 1945 2.0E-51
sp|A9N8R8|SUCC_COXBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=sucC PE=3 SV=1 1650 1925 3.0E-51
sp|B0RPQ9|SUCC_XANCB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain B100) GN=sucC PE=3 SV=1 1573 1946 3.0E-51
sp|Q8P676|SUCC_XANCP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=sucC PE=3 SV=1 1573 1946 4.0E-51
sp|Q4UXU0|SUCC_XANC8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Xanthomonas campestris pv. campestris (strain 8004) GN=sucC PE=3 SV=1 1573 1946 4.0E-51
sp|Q3A7Y4|SUCC_PELCD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=sucC PE=3 SV=1 1573 1925 5.0E-51
sp|B1JG57|SUCC_YERPY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|Q66DA0|SUCC_YERPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|A4TNT8|SUCC_YERPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis (strain Pestoides F) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|Q1CFM0|SUCC_YERPN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|A9R2F2|SUCC_YERPG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|Q8ZH00|SUCC_YERPE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|B2K8F1|SUCC_YERPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|Q1CAG1|SUCC_YERPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|A7FKR4|SUCC_YERP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sucC PE=3 SV=1 1575 1940 5.0E-51
sp|B1KPH0|SUCC_SHEWM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=sucC PE=3 SV=1 1666 1945 5.0E-51
sp|C3PNF9|SUCC_RICAE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia africae (strain ESF-5) GN=sucC PE=3 SV=1 1665 1944 5.0E-51
sp|Q9YI36|SUCB2_COLLI Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Columba livia GN=SUCLG2 PE=1 SV=1 1573 1925 6.0E-51
sp|Q0HW00|SUCC_SHESR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain MR-7) GN=sucC PE=3 SV=1 1666 1945 7.0E-51
sp|Q0HJQ4|SUCC_SHESM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain MR-4) GN=sucC PE=3 SV=1 1666 1945 7.0E-51
sp|Q4ULQ7|SUCC_RICFE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucC PE=3 SV=1 1665 1944 8.0E-51
sp|A0QBP0|SUCC_MYCA1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium avium (strain 104) GN=sucC PE=3 SV=1 1563 1943 8.0E-51
sp|Q9Z6T6|SUCC_CHLPN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia pneumoniae GN=sucC PE=3 SV=1 1631 1943 9.0E-51
sp|Q87RE8|SUCC_VIBPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sucC PE=3 SV=1 1666 1945 9.0E-51
sp|O05966|SUCC_RICPR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia prowazekii (strain Madrid E) GN=sucC PE=3 SV=1 1665 1944 1.0E-50
sp|A7N158|SUCC_VIBCB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=sucC PE=3 SV=1 1611 1945 1.0E-50
sp|Q1RH55|SUCC_RICBR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia bellii (strain RML369-C) GN=sucC PE=3 SV=1 1573 1925 1.0E-50
sp|Q98KT9|MTKA_RHILO Probable malate--CoA ligase subunit beta OS=Rhizobium loti (strain MAFF303099) GN=mtkA PE=3 SV=1 1615 1921 1.0E-50
sp|Q7MMN3|SUCC_VIBVY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio vulnificus (strain YJ016) GN=sucC PE=3 SV=1 1666 1945 1.0E-50
sp|Q8DFQ1|SUCC_VIBVU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio vulnificus (strain CMCP6) GN=sucC PE=3 SV=1 1666 1945 1.0E-50
sp|B2FRS3|SUCC_STRMK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Stenotrophomonas maltophilia (strain K279a) GN=sucC PE=3 SV=1 1573 1946 1.0E-50
sp|B4ST72|SUCC_STRM5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Stenotrophomonas maltophilia (strain R551-3) GN=sucC PE=3 SV=1 1573 1946 1.0E-50
sp|A1WLG5|SUCC_VEREI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Verminephrobacter eiseniae (strain EF01-2) GN=sucC PE=3 SV=1 1573 1944 1.0E-50
sp|Q2GJ42|SUCC_ANAPZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma phagocytophilum (strain HZ) GN=sucC PE=3 SV=1 1577 1942 1.0E-50
sp|A8H3H6|SUCC_SHEPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=sucC PE=3 SV=1 1666 1945 1.0E-50
sp|Q1AWI8|SUCC_RUBXD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=sucC PE=3 SV=1 1556 1944 1.0E-50
sp|Q12M63|SUCC_SHEDO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=sucC PE=3 SV=1 1666 1945 1.0E-50
sp|A1S5I0|SUCC_SHEAM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=sucC PE=3 SV=1 1666 1945 2.0E-50
sp|A9MJL9|SUCC_SALAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|Q96I99|SUCB2_HUMAN Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLG2 PE=1 SV=2 1573 1930 2.0E-50
sp|P66869|SUCC_SALTY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|P66870|SUCC_SALTI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella typhi GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B4TQ53|SUCC_SALSV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella schwarzengrund (strain CVM19633) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B5BC72|SUCC_SALPK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi A (strain AKU_12601) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|C0PWE7|SUCC_SALPC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi C (strain RKS4594) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|A9MTQ2|SUCC_SALPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|Q5PCM7|SUCC_SALPA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B4SZE2|SUCC_SALNS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella newport (strain SL254) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B4TBD7|SUCC_SALHS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella heidelberg (strain SL476) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B5R689|SUCC_SALG2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B5QWG8|SUCC_SALEP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella enteritidis PT4 (strain P125109) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|Q57RL3|SUCC_SALCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella choleraesuis (strain SC-B67) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|B5EZG1|SUCC_SALA4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salmonella agona (strain SL483) GN=sucC PE=3 SV=1 1556 1945 2.0E-50
sp|O28097|SUCC2_ARCFU Succinyl-CoA ligase [ADP-forming] subunit beta-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucC2 PE=3 SV=1 1573 1943 2.0E-50
sp|Q2NUM2|SUCC_SODGM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sodalis glossinidius (strain morsitans) GN=sucC PE=3 SV=1 1611 1945 2.0E-50
sp|Q7UKI3|SUCC_RHOBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=sucC PE=3 SV=2 1556 1925 2.0E-50
sp|Q8A9M7|SUCC_BACTN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=sucC PE=3 SV=1 1613 1918 2.0E-50
sp|Q21IW6|SUCC_SACD2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=sucC PE=3 SV=1 1666 1945 2.0E-50
sp|Q8EFN8|SUCC_SHEON Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella oneidensis (strain MR-1) GN=sucC PE=3 SV=1 1666 1945 3.0E-50
sp|Q2JFA7|SUCC_FRASC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Frankia sp. (strain CcI3) GN=sucC PE=3 SV=1 1563 1925 3.0E-50
sp|A8FX46|SUCC_SHESH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sediminis (strain HAW-EB3) GN=sucC PE=3 SV=1 1602 1945 3.0E-50
sp|A8GUV0|SUCC_RICB8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia bellii (strain OSU 85-389) GN=sucC PE=3 SV=1 1665 1925 4.0E-50
sp|A8GNF5|SUCC_RICAH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia akari (strain Hartford) GN=sucC PE=3 SV=1 1665 1925 4.0E-50
sp|P53592|SUCC_COXBU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucC PE=3 SV=2 1650 1925 4.0E-50
sp|Q2SD35|SUCC_HAHCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hahella chejuensis (strain KCTC 2396) GN=sucC PE=3 SV=1 1611 1925 4.0E-50
sp|Q3Z476|SUCC_SHISS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella sonnei (strain Ss046) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|P0A839|SUCC_SHIFL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella flexneri GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B1LLG1|SUCC_ECOSM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B6I7Z9|SUCC_ECOSE Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain SE11) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B7N9W6|SUCC_ECOLU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|P0A836|SUCC_ECOLI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12) GN=sucC PE=1 SV=1 1556 1945 4.0E-50
sp|B1IY02|SUCC_ECOLC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|P0A837|SUCC_ECOL6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|A7ZXY8|SUCC_ECOHS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O9:H4 (strain HS) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B1X6Q8|SUCC_ECODH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12 / DH10B) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|C4ZWK2|SUCC_ECOBW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B7NMS9|SUCC_ECO7I Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B5YQR7|SUCC_ECO5E Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|P0A838|SUCC_ECO57 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O157:H7 GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B7LAD4|SUCC_ECO55 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain 55989 / EAEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|A7ZJA8|SUCC_ECO24 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B6IZ97|SUCC_COXB2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain CbuG_Q212) GN=sucC PE=3 SV=1 1650 1925 4.0E-50
sp|Q32IK3|SUCC_SHIDS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B7M5P1|SUCC_ECO8A Succinyl-CoA ligase [ADP-forming] subunit beta OS=Escherichia coli O8 (strain IAI1) GN=sucC PE=3 SV=1 1556 1945 4.0E-50
sp|B6J8N7|SUCC_COXB1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain CbuK_Q154) GN=sucC PE=3 SV=1 1650 1925 5.0E-50
sp|B8CR00|SUCC_SHEPW Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=sucC PE=3 SV=1 1666 1943 5.0E-50
sp|A9KBQ4|SUCC_COXBN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Coxiella burnetii (strain Dugway 5J108-111) GN=sucC PE=3 SV=1 1650 1925 5.0E-50
sp|B0SAP0|SUCC_LEPBA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=sucC PE=3 SV=1 1625 1944 6.0E-50
sp|P53590|SUCB2_PIG Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLG2 PE=1 SV=2 1573 1944 6.0E-50
sp|A6GY30|SUCC_FLAPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=sucC PE=3 SV=1 1663 1930 7.0E-50
sp|C1A3F2|SUCC_RHOE4 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=sucC PE=3 SV=1 1563 1947 7.0E-50
sp|A1SWX6|SUCC_PSYIN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychromonas ingrahamii (strain 37) GN=sucC PE=3 SV=1 1666 1925 8.0E-50
sp|Q3INN3|SUCC_NATPD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=sucC PE=3 SV=1 1572 1943 8.0E-50
sp|A3DLR9|SUCC_STAMF Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=sucC PE=3 SV=1 1573 1944 8.0E-50
sp|A0KVX6|SUCC_SHESA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella sp. (strain ANA-3) GN=sucC PE=3 SV=1 1666 1945 1.0E-49
sp|Q68WU5|SUCC_RICTY Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucC PE=3 SV=1 1573 1944 1.0E-49
sp|Q9PL99|SUCC_CHLMU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=sucC PE=3 SV=1 1641 1944 1.0E-49
sp|B8GCC9|SUCC_CHLAD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=sucC PE=3 SV=1 1587 1945 2.0E-49
sp|C1AWW6|SUCC_RHOOB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodococcus opacus (strain B4) GN=sucC PE=3 SV=1 1563 1947 2.0E-49
sp|Q1LTZ4|SUCC_BAUCH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=sucC PE=3 SV=1 1573 1947 2.0E-49
sp|Q3IGW5|SUCC_PSEHT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=sucC PE=3 SV=1 1611 1925 2.0E-49
sp|A0R3M4|SUCC_MYCS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=sucC PE=1 SV=1 1563 1943 3.0E-49
sp|B4ESR1|SUCC_PROMH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Proteus mirabilis (strain HI4320) GN=sucC PE=3 SV=1 1611 1944 3.0E-49
sp|Q0T6W6|SUCC_SHIF8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella flexneri serotype 5b (strain 8401) GN=sucC PE=3 SV=1 1556 1945 3.0E-49
sp|C1ALT7|SUCC_MYCBT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sucC PE=3 SV=1 1563 1943 3.0E-49
sp|A1KH85|SUCC_MYCBP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sucC PE=3 SV=1 1563 1943 3.0E-49
sp|Q7U0Z1|SUCC_MYCBO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sucC PE=3 SV=1 1563 1943 3.0E-49
sp|B2HED1|SUCC_MYCMM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=sucC PE=3 SV=1 1563 1943 3.0E-49
sp|Q9Z2I8|SUCB2_MOUSE Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Suclg2 PE=1 SV=3 1565 1930 4.0E-49
sp|A4T6V7|SUCC_MYCGI Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=sucC PE=3 SV=1 1563 1943 4.0E-49
sp|A5FHX8|SUCC_FLAJ1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=sucC PE=3 SV=1 1663 1930 5.0E-49
sp|A0PWD1|SUCC_MYCUA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium ulcerans (strain Agy99) GN=sucC PE=3 SV=1 1563 1943 5.0E-49
sp|Q482S1|SUCC_COLP3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sucC PE=3 SV=1 1666 1945 5.0E-49
sp|A3QDH6|SUCC_SHELP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=sucC PE=3 SV=1 1666 1925 7.0E-49
sp|A8GB83|SUCC_SERP5 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Serratia proteamaculans (strain 568) GN=sucC PE=3 SV=1 1611 1940 7.0E-49
sp|C5BEM7|SUCC_EDWI9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Edwardsiella ictaluri (strain 93-146) GN=sucC PE=3 SV=1 1611 1945 8.0E-49
sp|B7VI35|SUCC_VIBTL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Vibrio tasmaniensis (strain LGP32) GN=sucC PE=3 SV=1 1666 1945 9.0E-49
sp|A1RTB8|SUCC_PYRIL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=sucC PE=3 SV=1 1573 1944 9.0E-49
sp|Q3MHX5|SUCB2_BOVIN Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLG2 PE=2 SV=1 1573 1930 1.0E-48
sp|Q5PBI8|SUCC_ANAMM Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma marginale (strain St. Maries) GN=sucC PE=3 SV=1 1598 1936 1.0E-48
sp|P9WGC5|SUCC_MYCTU Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sucC PE=1 SV=1 1563 1943 1.0E-48
sp|P9WGC4|SUCC_MYCTO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sucC PE=3 SV=1 1563 1943 1.0E-48
sp|A5U0Z1|SUCC_MYCTA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sucC PE=3 SV=1 1563 1943 1.0E-48
sp|Q6ARL2|SUCC_DESPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=sucC PE=3 SV=1 1650 1925 1.0E-48
sp|C5C916|SUCC_MICLC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=sucC PE=3 SV=1 1569 1946 2.0E-48
sp|Q324I4|SUCC_SHIBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella boydii serotype 4 (strain Sb227) GN=sucC PE=3 SV=1 1556 1945 2.0E-48
sp|B2TUB2|SUCC_SHIB3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sucC PE=3 SV=1 1556 1945 2.0E-48
sp|B9LRR0|SUCC_HALLT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=sucC PE=3 SV=1 1572 1943 2.0E-48
sp|A6VZ30|SUCC_MARMS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Marinomonas sp. (strain MWYL1) GN=sucC PE=3 SV=1 1582 1945 2.0E-48
sp|A6VPM2|SUCC_ACTSZ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=sucC PE=3 SV=1 1666 1944 2.0E-48
sp|A3MWQ7|SUCC_PYRCJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=sucC PE=3 SV=1 1573 1944 2.0E-48
sp|A1TEP3|SUCC_MYCVP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=sucC PE=3 SV=1 1563 1943 3.0E-48
sp|B8D5I6|SUCC_DESK1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=sucC PE=3 SV=1 1573 1946 3.0E-48
sp|Q0VPF7|SUCC_ALCBS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=sucC PE=3 SV=1 1611 1946 4.0E-48
sp|C6DCD6|SUCC_PECCP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=sucC PE=3 SV=1 1575 1945 5.0E-48
sp|B1W3P6|SUCC_STRGG Succinyl-CoA ligase [ADP-forming] subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=sucC PE=3 SV=1 1569 1922 5.0E-48
sp|B2VBR6|SUCC_ERWT9 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sucC PE=3 SV=1 1575 1945 6.0E-48
sp|Q1B3V2|SUCC_MYCSS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium sp. (strain MCS) GN=sucC PE=3 SV=1 1563 1943 6.0E-48
sp|A1UL96|SUCC_MYCSK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium sp. (strain KMS) GN=sucC PE=3 SV=1 1563 1943 6.0E-48
sp|A3Q5P5|SUCC_MYCSJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium sp. (strain JLS) GN=sucC PE=3 SV=1 1563 1943 6.0E-48
sp|Q31FV4|SUCC_THICR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Thiomicrospira crunogena (strain XCL-2) GN=sucC PE=3 SV=1 1647 1943 9.0E-48
sp|Q4FVH9|SUCC_PSYA2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=sucC PE=3 SV=1 1584 1945 9.0E-48
sp|B0TJP8|SUCC_SHEHH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Shewanella halifaxensis (strain HAW-EB4) GN=sucC PE=3 SV=1 1666 1925 1.0E-47
sp|C4L8V5|SUCC_TOLAT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=sucC PE=3 SV=1 1584 1944 1.0E-47
sp|B2GM49|SUCC_KOCRD Succinyl-CoA ligase [ADP-forming] subunit beta OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=sucC PE=3 SV=1 1569 1947 2.0E-47
sp|Q5V4Q4|SUCC_HALMA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=sucC PE=3 SV=1 1572 1948 2.0E-47
sp|Q6D7G2|SUCC_PECAS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sucC PE=3 SV=1 1650 1925 2.0E-47
sp|A4WL16|SUCC_PYRAR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=sucC PE=3 SV=1 1573 1945 3.0E-47
sp|Q64U25|SUCC_BACFR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis (strain YCH46) GN=sucC PE=3 SV=1 1650 1920 5.0E-47
sp|Q5LCW4|SUCC_BACFN Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=sucC PE=3 SV=1 1650 1920 5.0E-47
sp|Q1QEK5|SUCC_PSYCK Succinyl-CoA ligase [ADP-forming] subunit beta OS=Psychrobacter cryohalolentis (strain K5) GN=sucC PE=3 SV=1 1584 1945 5.0E-47
sp|A1TZS9|SUCC_MARHV Succinyl-CoA ligase [ADP-forming] subunit beta OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sucC PE=3 SV=1 1611 1945 9.0E-47
sp|A7MQX5|SUCC_CROS8 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=sucC PE=3 SV=1 1611 1945 1.0E-46
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003796 lysozyme activity Yes
GO:0003824 catalytic activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0009253 peptidoglycan catabolic process Yes
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0006022 aminoglycan metabolic process No
GO:0009056 catabolic process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0044237 cellular metabolic process No
GO:0044036 cell wall macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0009057 macromolecule catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006026 aminoglycan catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0003674 molecular_function No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 756 778 22
2 785 807 22
3 811 833 22
4 846 868 22
5 872 894 22
6 915 937 22
7 957 979 22
8 1000 1022 22
9 1049 1071 22
10 1084 1106 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3599
MKPQAALLPSLLPAIVASLSSIPSALYTSSGTGFFALSEARVIDVDACYAVARDGLGSTLIPPSLLDFALTFSRD
VEAVLGFRIPVSHEGRSRARGIFLTIDDDASAYTDAAGRKTSEGYSLTVNSSGIFIAGASPLGVWWATRTVLHQG
LLHGRIPHGHGRDAPAWRERGMMLDAGRHFYPTGFLTELCAYMSFFKQNVLHLHLSDNLYNNKKYTREQSLRLGA
WFRLWSDAQELRGLSSGRNESYSRSEMEDLQRTCAARGVTIVPELEAPGHALPIVQWRPQLGLRKDLSQLNISHP
ETIPTIKMIWRHFLPWFHSKVVSIGADEYTGPVNDYGRFVNSMNAFIQQESNKTKAVRIWGTFPPDKRPSFVNVD
RDVSIQHWSYHEDNPYYDFIRNGYSVVNSMHDFYVVSKWGHYPNTLDAARTFDGNPNGKEPWYPHIFNLHKASDN
ARRDEPLVIGAITPLWNDYGPNASVYSEAYYAWRRGLPALADKQWGGRLTSRQFDRLFTDLYPHAPAQNLERRIP
SKGDVIFEYDLSQMVSSTSNTIKDLSPNGYDAITNCAPMDSSLHMTPKCELKTPWSSKGRDYTLTVKLKIERLTD
SGNTTLLVGADSVLMLTPTITLFASGTYHHLKLYFPMGEWIELSLRGRGNQTFISLERMRDKVAMGEEEFRVVMG
IDGERLHSDVVAIEAPIEKSFEADDDAQLLPPTDTGRGAYVALACCTVSQAPIWGYSVSFGIFQEYYSNDSGIPG
SPGAFASIGAAQVGVMYLLMPVIFVLLYRRPRWRPWCGRLGLLITMASISASAFVSTVHGLIVTQGVVYALGCAL
LFSPVSVYMDEWFVRFKGAAYGVMWGGKSAVGVGMPFVFSAMLSRFGLRITLLSWAVASALLTLPALVLMKPRLP
LPAAGDVRGSRPLSWRFIRCTVFWMMQLGVVIQSLGYMMPSTYLASYALAIGLPPVTGPLLLAAFSLASVPGSII
HGFLGDKVSASKAILMSSFGSALPVFLLWGLSLHFANVMAFALAFGFFAGGFSSTWSGMVNEIQKVDASAESSIV
FGMLLGGRGLGFVLSGPVSGALLSTRSRLMDGTLGYATIYGPMIIFTGTTAVLGAWGAYCFEASSVHGAVDFGQA
YADGARFAIIRASSVSYSSCIHRTFRQFQQQAADAGLIRGGYHVGQPERAFGGIQAKYFLQNGGGWINDGMTLPG
MMVLTDRDHRETRTCYGMTPKEIQRWIIEFTEVYRASTSIYPMLYTTTGWWKQCTGNTINLMNRALLVVSDHGDR
LGELPAGWKKHTFWEYSASSPWAGGSTAAADIASLLSQKLARSTTVHRQKLDANQLQKLCLTLGTPRLGDVDVSL
RPPPDGSPVPPGYHLVYFTPLVPESSLGPDGSDATFNAPAPFTRRMWAGGTMSWSGDALRVGDEVEERTRLVRAT
AKEGSKGDMILVDVEKELVSSRGCSVVDRRAWIFRPGLSTPVMPVTSSYKGQATVEQGQPEEDQLNHVPTRSLSW
SQTALFRFSALTFNAHKIHYDKDWCQKVEGHPSPVVHGPLTLLSMLDHWRDVHGSGKQLLSIDYRALKPVYAGET
TPRTRLVGSVDEARDAIKELGIPCIFAVEKQGRQGAFGSGSPADHKLIDTVDKATAIASQILNRRSSNQDSSLIM
SQLRVTEHIQSDANWYLAISINRESYGPAITISRRGGMTIDEIARVYPDSLYTFPFTLSTGITTSLMSQIQTQLQ
LSSVQSSSLKHLLHQAFTVFSKKDATLFEINPMTMSKDGSIASLSTNLLIDDAAKKRQPELSALRDRSQDVAEEV
EAEKHGLVYVKMEGDIGIVVNGAGLAMATNDAIGSHGGKSANFLDTGGKATTETMMKAFEIVTRDERVKAILVNI
YGGLTRCDMIAQSIIGAARGLDVRVPMVVRLQGTNSEQGLKMLEEADLDIDMVVESDWRAARRVVELARGAESTN
TCK*
Coding >Ophun1|3599
ATGAAGCCACAAGCCGCGCTGCTGCCGTCACTGCTACCGGCCATCGTCGCCAGCCTCTCCAGCATCCCCTCCGCG
CTGTACACCTCGTCTGGAACGGGCTTCTTTGCTCTGTCCGAGGCGCGGGTCATTGACGTGGACGCCTGCTATGCT
GTGGCGAGGGATGGGCTCGGATCGACGCTTATTCCCCCTTCGTTACTCGACTTTGCTCTCACCTTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTCCGCATTCCCGTCAGTCATGAGGGTAGAAGCCGGGCAAGGGGCATCTTCCTCACC
ATCGACGACGATGCTTCGGCTTACACCGACGCTGCCGGCCGAAAGACCTCGGAGGGCTACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGAGTCTGGTGGGCCACCCGGACCGTCCTCCACCAGGGC
CTTCTCCACGGCCGGATCCCCCATGGCCATGGCCGGGATGCTCCGGCCTGGAGAGAGCGCGGCATGATGCTCGAC
GCCGGCCGACATTTCTACCCAACGGGGTTCCTCACGGAGCTGTGCGCGTACATGTCCTTCTTCAAGCAGAATGTT
CTTCACCTGCATCTCAGCGATAATCTATACAATAATAAGAAGTACACGCGCGAACAGTCGCTACGCCTCGGCGCC
TGGTTCCGCCTCTGGTCTGACGCCCAAGAGCTTCGAGGCCTCAGCTCCGGCCGCAACGAGTCATACTCTCGCTCT
GAGATGGAGGACCTTCAGCGGACTTGTGCTGCCCGAGGCGTCACCATCGTGCCGGAGTTGGAGGCTCCGGGCCAT
GCGCTCCCCATTGTTCAGTGGCGGCCGCAGCTGGGGCTGAGAAAGGACCTGAGCCAGCTCAACATCTCGCATCCG
GAGACGATACCGACTATCAAGATGATTTGGCGTCATTTCTTGCCCTGGTTTCACTCCAAAGTCGTCTCTATAGGG
GCTGATGAGTACACGGGGCCGGTCAATGACTACGGTCGCTTCGTCAACTCGATGAATGCCTTTATCCAGCAAGAG
TCTAACAAGACCAAGGCGGTGCGGATCTGGGGCACCTTTCCTCCAGATAAGAGACCGAGCTTCGTCAATGTAGAT
CGCGACGTCTCGATTCAGCACTGGAGTTACCACGAAGACAACCCTTACTACGACTTCATCCGCAACGGCTACTCC
GTCGTCAACTCCATGCACGACTTCTACGTCGTCAGCAAATGGGGCCATTACCCAAACACCCTCGACGCTGCCAGG
ACCTTTGATGGCAACCCCAATGGCAAGGAGCCGTGGTATCCTCACATCTTCAACTTGCACAAGGCGTCTGACAAT
GCACGACGCGACGAGCCTCTCGTCATTGGCGCCATCACGCCCCTATGGAACGACTACGGGCCCAATGCCAGTGTC
TACTCAGAAGCCTATTACGCCTGGCGCCGAGGCTTGCCCGCCCTGGCTGATAAGCAATGGGGCGGACGGCTGACG
TCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCTCACGCACCGGCTCAGAACCTAGAGAGGAGGATCCCG
TCCAAGGGGGATGTCATATTCGAGTACGATCTCAGCCAGATGGTCTCGAGCACGAGCAATACCATCAAGGATCTC
TCACCCAATGGCTACGACGCCATCACCAACTGCGCGCCCATGGACTCGTCTCTCCATATGACGCCGAAATGCGAG
CTGAAGACGCCCTGGAGTTCCAAGGGAAGAGACTACACCCTGACCGTGAAGCTCAAGATCGAACGTCTCACCGAT
TCCGGAAACACGACGCTCCTCGTCGGCGCAGACTCAGTCCTGATGCTCACGCCCACCATCACCCTCTTCGCATCC
GGAACCTACCACCACCTGAAACTCTACTTCCCCATGGGTGAATGGATCGAGTTGAGTCTACGGGGTCGCGGGAAC
CAGACGTTCATCTCGCTCGAGCGTATGAGGGACAAGGTCGCCATGGGAGAGGAAGAGTTTCGCGTGGTAATGGGC
ATCGACGGTGAGCGCCTTCACTCGGATGTTGTGGCCATAGAGGCCCCCATAGAAAAGAGTTTCGAAGCGGACGAC
GATGCACAGCTTCTACCGCCTACAGACACCGGTCGAGGGGCGTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAA
GCTCCCATCTGGGGATACTCGGTCTCGTTCGGCATCTTTCAAGAATACTACAGCAACGACAGCGGCATCCCCGGC
TCTCCCGGGGCCTTTGCCTCTATAGGCGCCGCTCAGGTAGGCGTCATGTACCTCCTGATGCCCGTCATCTTCGTC
CTCCTCTACCGGAGACCGCGATGGCGCCCCTGGTGCGGAAGACTGGGCCTGCTCATCACCATGGCCAGCATCTCG
GCCTCGGCCTTCGTCTCGACTGTTCACGGCCTCATCGTTACTCAGGGGGTTGTCTATGCTCTCGGCTGCGCGCTG
CTCTTCAGCCCCGTCTCCGTCTATATGGATGAGTGGTTCGTTCGCTTCAAGGGCGCGGCCTACGGTGTCATGTGG
GGAGGGAAGTCGGCTGTTGGTGTTGGCATGCCCTTTGTTTTCAGTGCCATGCTGAGCCGCTTTGGTTTGAGGATC
ACGCTTCTCTCCTGGGCTGTTGCTTCTGCGTTGTTGACGCTGCCGGCTCTCGTTCTCATGAAGCCTAGGCTGCCT
CTGCCCGCTGCTGGCGACGTCCGTGGCTCCCGGCCGCTGTCCTGGCGCTTCATCCGCTGTACCGTCTTCTGGATG
ATGCAGTTGGGCGTCGTGATACAGTCGCTGGGCTACATGATGCCCTCTACGTATCTGGCCAGCTACGCCTTGGCC
ATCGGCTTGCCTCCAGTCACGGGGCCGCTGCTCTTGGCTGCCTTCTCGTTGGCTTCGGTGCCCGGTTCCATCATC
CACGGATTCCTCGGCGACAAGGTGTCTGCCAGCAAGGCCATCTTGATGTCTTCGTTCGGAAGCGCCCTGCCCGTC
TTTCTGCTCTGGGGGCTGAGCCTTCACTTTGCAAATGTCATGGCCTTTGCCCTCGCTTTTGGCTTCTTTGCCGGG
GGTTTCAGCTCTACCTGGTCGGGAATGGTCAACGAGATCCAGAAAGTCGACGCCAGTGCCGAATCGTCTATTGTC
TTTGGCATGCTTCTCGGCGGTCGAGGACTGGGCTTTGTTTTGAGCGGTCCCGTCAGCGGAGCTCTGCTTTCAACG
CGGTCGAGGCTGATGGACGGGACACTGGGATACGCTACTATCTATGGCCCAATGATCATCTTCACCGGCACCACG
GCGGTCTTGGGTGCCTGGGGGGCTTATTGCTTCGAGGCTTCGAGCGTCCATGGCGCCGTCGACTTTGGTCAGGCC
TACGCTGATGGAGCTCGCTTCGCCATCATCAGGGCCAGCTCTGTCAGCTACTCCTCATGTATCCACCGCACATTC
AGGCAATTCCAGCAACAAGCCGCAGACGCAGGTCTAATCCGCGGGGGATACCACGTCGGCCAGCCGGAGAGGGCC
TTTGGCGGCATCCAGGCCAAGTACTTTCTCCAGAACGGCGGCGGCTGGATTAACGACGGCATGACGCTGCCCGGA
ATGATGGTCTTGACGGATAGAGACCACCGGGAGACACGAACGTGCTACGGCATGACGCCCAAGGAGATTCAGCGC
TGGATCATCGAGTTCACCGAAGTCTACCGCGCCTCGACGAGCATCTACCCGATGTTGTACACCACGACGGGCTGG
TGGAAGCAGTGCACCGGCAACACGATTAATCTCATGAACCGCGCTCTGCTCGTCGTCTCGGATCACGGTGACAGG
CTCGGTGAGCTGCCGGCGGGCTGGAAGAAGCACACATTCTGGGAATATTCAGCCAGTTCTCCTTGGGCGGGCGGG
TCCACCGCAGCAGCAGACATCGCCTCCCTCCTCTCCCAAAAGCTCGCCCGCTCAACGACAGTCCATCGCCAGAAG
CTCGACGCAAACCAGCTGCAGAAGCTCTGTCTGACGCTCGGAACCCCTCGTCTCGGGGACGTCGACGTCTCGCTC
CGGCCGCCTCCGGATGGATCCCCCGTTCCCCCGGGCTATCATCTCGTCTACTTCACCCCTCTCGTTCCCGAGTCG
AGCCTCGGTCCGGACGGGAGTGACGCTACCTTTAATGCTCCGGCTCCGTTTACTAGGCGGATGTGGGCGGGAGGG
ACCATGTCCTGGTCGGGCGACGCGCTCCGTGTAGGGGACGAGGTTGAGGAGCGGACGAGGCTGGTGAGGGCTACG
GCGAAGGAGGGCTCCAAGGGAGATATGATTCTCGTCGACGTAGAGAAGGAGTTGGTGTCTTCTCGAGGCTGCTCG
GTGGTTGATCGACGAGCGTGGATCTTCCGGCCCGGGCTGAGCACTCCGGTGATGCCGGTCACGTCGTCTTATAAA
GGCCAGGCTACGGTGGAACAAGGGCAACCGGAAGAGGACCAGCTCAATCATGTTCCAACCCGTAGCCTCTCCTGG
TCCCAAACAGCCCTATTCCGATTCTCAGCCCTCACCTTCAACGCACACAAAATCCACTACGACAAAGACTGGTGT
CAAAAGGTCGAGGGCCACCCATCGCCCGTCGTCCACGGGCCGCTGACGTTGCTCTCCATGCTCGACCACTGGCGC
GACGTTCACGGCTCGGGAAAGCAGCTGCTCTCCATCGACTATCGCGCCCTGAAGCCGGTATATGCTGGCGAAACG
ACTCCGCGGACTAGGCTCGTTGGGTCTGTGGATGAGGCTCGGGACGCCATCAAGGAACTGGGCATCCCGTGTATC
TTCGCAGTAGAAAAGCAAGGTCGACAAGGCGCCTTTGGAAGCGGCTCACCAGCGGACCATAAGCTGATAGACACC
GTCGACAAGGCCACAGCAATAGCATCGCAGATTCTCAACCGCCGAAGCTCCAACCAAGACAGTTCCCTCATAATG
AGCCAGCTGCGCGTGACAGAACACATCCAATCCGATGCAAACTGGTATCTCGCCATATCTATCAACAGAGAGAGC
TACGGACCGGCCATAACCATTTCGAGGCGAGGCGGCATGACCATCGATGAGATAGCCAGGGTCTACCCCGACAGC
CTCTACACCTTTCCCTTTACTCTCTCAACCGGCATCACGACAAGCCTCATGTCACAAATACAAACACAACTCCAG
CTATCAAGCGTCCAATCCAGCAGTCTCAAGCACCTCCTACACCAAGCATTCACCGTCTTCTCCAAGAAAGACGCG
ACCCTCTTCGAAATCAACCCAATGACCATGTCAAAAGACGGAAGCATAGCCAGCCTCAGCACAAACCTCCTCATC
GACGACGCCGCAAAGAAGCGCCAGCCGGAACTATCGGCCCTCCGGGATAGAAGCCAAGATGTCGCGGAAGAAGTC
GAGGCGGAGAAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACATTGGCATCGTCGTCAATGGGGCTGGACTG
GCGATGGCTACCAACGATGCCATTGGCTCTCACGGCGGGAAGAGCGCAAACTTTCTTGATACGGGTGGGAAGGCG
ACTACGGAGACGATGATGAAGGCATTTGAGATTGTGACGCGGGACGAGAGGGTCAAGGCTATCCTCGTCAACATC
TACGGGGGCCTCACCCGCTGCGACATGATTGCCCAGTCCATCATCGGCGCCGCGCGGGGGCTGGACGTGCGGGTG
CCGATGGTGGTTCGGCTTCAGGGGACCAACTCGGAGCAGGGTCTCAAGATGCTCGAGGAGGCCGACTTGGACATC
GATATGGTGGTTGAGTCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGGGGAGCTGAGTCTACGAAT
ACATGCAAATGA
Transcript >Ophun1|3599
ATGAAGCCACAAGCCGCGCTGCTGCCGTCACTGCTACCGGCCATCGTCGCCAGCCTCTCCAGCATCCCCTCCGCG
CTGTACACCTCGTCTGGAACGGGCTTCTTTGCTCTGTCCGAGGCGCGGGTCATTGACGTGGACGCCTGCTATGCT
GTGGCGAGGGATGGGCTCGGATCGACGCTTATTCCCCCTTCGTTACTCGACTTTGCTCTCACCTTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTCCGCATTCCCGTCAGTCATGAGGGTAGAAGCCGGGCAAGGGGCATCTTCCTCACC
ATCGACGACGATGCTTCGGCTTACACCGACGCTGCCGGCCGAAAGACCTCGGAGGGCTACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGAGTCTGGTGGGCCACCCGGACCGTCCTCCACCAGGGC
CTTCTCCACGGCCGGATCCCCCATGGCCATGGCCGGGATGCTCCGGCCTGGAGAGAGCGCGGCATGATGCTCGAC
GCCGGCCGACATTTCTACCCAACGGGGTTCCTCACGGAGCTGTGCGCGTACATGTCCTTCTTCAAGCAGAATGTT
CTTCACCTGCATCTCAGCGATAATCTATACAATAATAAGAAGTACACGCGCGAACAGTCGCTACGCCTCGGCGCC
TGGTTCCGCCTCTGGTCTGACGCCCAAGAGCTTCGAGGCCTCAGCTCCGGCCGCAACGAGTCATACTCTCGCTCT
GAGATGGAGGACCTTCAGCGGACTTGTGCTGCCCGAGGCGTCACCATCGTGCCGGAGTTGGAGGCTCCGGGCCAT
GCGCTCCCCATTGTTCAGTGGCGGCCGCAGCTGGGGCTGAGAAAGGACCTGAGCCAGCTCAACATCTCGCATCCG
GAGACGATACCGACTATCAAGATGATTTGGCGTCATTTCTTGCCCTGGTTTCACTCCAAAGTCGTCTCTATAGGG
GCTGATGAGTACACGGGGCCGGTCAATGACTACGGTCGCTTCGTCAACTCGATGAATGCCTTTATCCAGCAAGAG
TCTAACAAGACCAAGGCGGTGCGGATCTGGGGCACCTTTCCTCCAGATAAGAGACCGAGCTTCGTCAATGTAGAT
CGCGACGTCTCGATTCAGCACTGGAGTTACCACGAAGACAACCCTTACTACGACTTCATCCGCAACGGCTACTCC
GTCGTCAACTCCATGCACGACTTCTACGTCGTCAGCAAATGGGGCCATTACCCAAACACCCTCGACGCTGCCAGG
ACCTTTGATGGCAACCCCAATGGCAAGGAGCCGTGGTATCCTCACATCTTCAACTTGCACAAGGCGTCTGACAAT
GCACGACGCGACGAGCCTCTCGTCATTGGCGCCATCACGCCCCTATGGAACGACTACGGGCCCAATGCCAGTGTC
TACTCAGAAGCCTATTACGCCTGGCGCCGAGGCTTGCCCGCCCTGGCTGATAAGCAATGGGGCGGACGGCTGACG
TCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCTCACGCACCGGCTCAGAACCTAGAGAGGAGGATCCCG
TCCAAGGGGGATGTCATATTCGAGTACGATCTCAGCCAGATGGTCTCGAGCACGAGCAATACCATCAAGGATCTC
TCACCCAATGGCTACGACGCCATCACCAACTGCGCGCCCATGGACTCGTCTCTCCATATGACGCCGAAATGCGAG
CTGAAGACGCCCTGGAGTTCCAAGGGAAGAGACTACACCCTGACCGTGAAGCTCAAGATCGAACGTCTCACCGAT
TCCGGAAACACGACGCTCCTCGTCGGCGCAGACTCAGTCCTGATGCTCACGCCCACCATCACCCTCTTCGCATCC
GGAACCTACCACCACCTGAAACTCTACTTCCCCATGGGTGAATGGATCGAGTTGAGTCTACGGGGTCGCGGGAAC
CAGACGTTCATCTCGCTCGAGCGTATGAGGGACAAGGTCGCCATGGGAGAGGAAGAGTTTCGCGTGGTAATGGGC
ATCGACGGTGAGCGCCTTCACTCGGATGTTGTGGCCATAGAGGCCCCCATAGAAAAGAGTTTCGAAGCGGACGAC
GATGCACAGCTTCTACCGCCTACAGACACCGGTCGAGGGGCGTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAA
GCTCCCATCTGGGGATACTCGGTCTCGTTCGGCATCTTTCAAGAATACTACAGCAACGACAGCGGCATCCCCGGC
TCTCCCGGGGCCTTTGCCTCTATAGGCGCCGCTCAGGTAGGCGTCATGTACCTCCTGATGCCCGTCATCTTCGTC
CTCCTCTACCGGAGACCGCGATGGCGCCCCTGGTGCGGAAGACTGGGCCTGCTCATCACCATGGCCAGCATCTCG
GCCTCGGCCTTCGTCTCGACTGTTCACGGCCTCATCGTTACTCAGGGGGTTGTCTATGCTCTCGGCTGCGCGCTG
CTCTTCAGCCCCGTCTCCGTCTATATGGATGAGTGGTTCGTTCGCTTCAAGGGCGCGGCCTACGGTGTCATGTGG
GGAGGGAAGTCGGCTGTTGGTGTTGGCATGCCCTTTGTTTTCAGTGCCATGCTGAGCCGCTTTGGTTTGAGGATC
ACGCTTCTCTCCTGGGCTGTTGCTTCTGCGTTGTTGACGCTGCCGGCTCTCGTTCTCATGAAGCCTAGGCTGCCT
CTGCCCGCTGCTGGCGACGTCCGTGGCTCCCGGCCGCTGTCCTGGCGCTTCATCCGCTGTACCGTCTTCTGGATG
ATGCAGTTGGGCGTCGTGATACAGTCGCTGGGCTACATGATGCCCTCTACGTATCTGGCCAGCTACGCCTTGGCC
ATCGGCTTGCCTCCAGTCACGGGGCCGCTGCTCTTGGCTGCCTTCTCGTTGGCTTCGGTGCCCGGTTCCATCATC
CACGGATTCCTCGGCGACAAGGTGTCTGCCAGCAAGGCCATCTTGATGTCTTCGTTCGGAAGCGCCCTGCCCGTC
TTTCTGCTCTGGGGGCTGAGCCTTCACTTTGCAAATGTCATGGCCTTTGCCCTCGCTTTTGGCTTCTTTGCCGGG
GGTTTCAGCTCTACCTGGTCGGGAATGGTCAACGAGATCCAGAAAGTCGACGCCAGTGCCGAATCGTCTATTGTC
TTTGGCATGCTTCTCGGCGGTCGAGGACTGGGCTTTGTTTTGAGCGGTCCCGTCAGCGGAGCTCTGCTTTCAACG
CGGTCGAGGCTGATGGACGGGACACTGGGATACGCTACTATCTATGGCCCAATGATCATCTTCACCGGCACCACG
GCGGTCTTGGGTGCCTGGGGGGCTTATTGCTTCGAGGCTTCGAGCGTCCATGGCGCCGTCGACTTTGGTCAGGCC
TACGCTGATGGAGCTCGCTTCGCCATCATCAGGGCCAGCTCTGTCAGCTACTCCTCATGTATCCACCGCACATTC
AGGCAATTCCAGCAACAAGCCGCAGACGCAGGTCTAATCCGCGGGGGATACCACGTCGGCCAGCCGGAGAGGGCC
TTTGGCGGCATCCAGGCCAAGTACTTTCTCCAGAACGGCGGCGGCTGGATTAACGACGGCATGACGCTGCCCGGA
ATGATGGTCTTGACGGATAGAGACCACCGGGAGACACGAACGTGCTACGGCATGACGCCCAAGGAGATTCAGCGC
TGGATCATCGAGTTCACCGAAGTCTACCGCGCCTCGACGAGCATCTACCCGATGTTGTACACCACGACGGGCTGG
TGGAAGCAGTGCACCGGCAACACGATTAATCTCATGAACCGCGCTCTGCTCGTCGTCTCGGATCACGGTGACAGG
CTCGGTGAGCTGCCGGCGGGCTGGAAGAAGCACACATTCTGGGAATATTCAGCCAGTTCTCCTTGGGCGGGCGGG
TCCACCGCAGCAGCAGACATCGCCTCCCTCCTCTCCCAAAAGCTCGCCCGCTCAACGACAGTCCATCGCCAGAAG
CTCGACGCAAACCAGCTGCAGAAGCTCTGTCTGACGCTCGGAACCCCTCGTCTCGGGGACGTCGACGTCTCGCTC
CGGCCGCCTCCGGATGGATCCCCCGTTCCCCCGGGCTATCATCTCGTCTACTTCACCCCTCTCGTTCCCGAGTCG
AGCCTCGGTCCGGACGGGAGTGACGCTACCTTTAATGCTCCGGCTCCGTTTACTAGGCGGATGTGGGCGGGAGGG
ACCATGTCCTGGTCGGGCGACGCGCTCCGTGTAGGGGACGAGGTTGAGGAGCGGACGAGGCTGGTGAGGGCTACG
GCGAAGGAGGGCTCCAAGGGAGATATGATTCTCGTCGACGTAGAGAAGGAGTTGGTGTCTTCTCGAGGCTGCTCG
GTGGTTGATCGACGAGCGTGGATCTTCCGGCCCGGGCTGAGCACTCCGGTGATGCCGGTCACGTCGTCTTATAAA
GGCCAGGCTACGGTGGAACAAGGGCAACCGGAAGAGGACCAGCTCAATCATGTTCCAACCCGTAGCCTCTCCTGG
TCCCAAACAGCCCTATTCCGATTCTCAGCCCTCACCTTCAACGCACACAAAATCCACTACGACAAAGACTGGTGT
CAAAAGGTCGAGGGCCACCCATCGCCCGTCGTCCACGGGCCGCTGACGTTGCTCTCCATGCTCGACCACTGGCGC
GACGTTCACGGCTCGGGAAAGCAGCTGCTCTCCATCGACTATCGCGCCCTGAAGCCGGTATATGCTGGCGAAACG
ACTCCGCGGACTAGGCTCGTTGGGTCTGTGGATGAGGCTCGGGACGCCATCAAGGAACTGGGCATCCCGTGTATC
TTCGCAGTAGAAAAGCAAGGTCGACAAGGCGCCTTTGGAAGCGGCTCACCAGCGGACCATAAGCTGATAGACACC
GTCGACAAGGCCACAGCAATAGCATCGCAGATTCTCAACCGCCGAAGCTCCAACCAAGACAGTTCCCTCATAATG
AGCCAGCTGCGCGTGACAGAACACATCCAATCCGATGCAAACTGGTATCTCGCCATATCTATCAACAGAGAGAGC
TACGGACCGGCCATAACCATTTCGAGGCGAGGCGGCATGACCATCGATGAGATAGCCAGGGTCTACCCCGACAGC
CTCTACACCTTTCCCTTTACTCTCTCAACCGGCATCACGACAAGCCTCATGTCACAAATACAAACACAACTCCAG
CTATCAAGCGTCCAATCCAGCAGTCTCAAGCACCTCCTACACCAAGCATTCACCGTCTTCTCCAAGAAAGACGCG
ACCCTCTTCGAAATCAACCCAATGACCATGTCAAAAGACGGAAGCATAGCCAGCCTCAGCACAAACCTCCTCATC
GACGACGCCGCAAAGAAGCGCCAGCCGGAACTATCGGCCCTCCGGGATAGAAGCCAAGATGTCGCGGAAGAAGTC
GAGGCGGAGAAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACATTGGCATCGTCGTCAATGGGGCTGGACTG
GCGATGGCTACCAACGATGCCATTGGCTCTCACGGCGGGAAGAGCGCAAACTTTCTTGATACGGGTGGGAAGGCG
ACTACGGAGACGATGATGAAGGCATTTGAGATTGTGACGCGGGACGAGAGGGTCAAGGCTATCCTCGTCAACATC
TACGGGGGCCTCACCCGCTGCGACATGATTGCCCAGTCCATCATCGGCGCCGCGCGGGGGCTGGACGTGCGGGTG
CCGATGGTGGTTCGGCTTCAGGGGACCAACTCGGAGCAGGGTCTCAAGATGCTCGAGGAGGCCGACTTGGACATC
GATATGGTGGTTGAGTCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGGGGAGCTGAGTCTACGAAT
ACATGCAAATGA
Gene >Ophun1|3599
ATGAAGCCACAAGCCGCGCTGCTGCCGTCACTGCTACCGGCCATCGTCGCCAGCCTCTCCAGCATCCCCTCCGCG
CTGTACACCTCGTCTGGAACGGGCTTCTTTGCTCTGTCCGAGGCGCGGGTCATTGACGTGGACGCCTGCTATGCT
GTGGCGAGGGATGGGCTCGGATCGACGCTTATTCCCCCTTCGTTACTCGACTTTGCTCTCACCTTCAGCCGCGAT
GTCGAGGCCGTCTTGGGCTTCCGCATTCCCGTCAGTCATGAGGGTAGAAGCCGGGCAAGGGGCATCTTCCTCACC
ATCGACGACGATGCTTCGGCTTACACCGACGCTGCCGGCCGAAAGACCTCGGAGGGCTACTCCCTGACCGTCAAC
TCATCCGGCATCTTCATCGCCGGCGCCAGCCCTCTCGGAGTCTGGTGGGCCACCCGGACCGTCCTCCACCAGGGC
CTTCTCCACGGCCGGATCCCCCATGGCCATGGCCGGGATGCTCCGGCCTGGAGAGAGCGCGGCATGATGCTCGAC
GCCGGCCGACATTTCTACCCAACGGGGTTCCTCACGGAGCTGTGCGCGTACATGTCCTTCTTCAAGCAGAATGTT
CTTCACCTGCATCTCAGCGATAATCTATACAATAATAAGAAGTACACGCGCGAACAGTCGCTACGCCTCGGCGCC
TGGTTCCGCCTCTGGTCTGACGCCCAAGAGCTTCGAGGCCTCAGCTCCGGCCGCAACGAGTCATACTCTCGCTCT
GAGATGGAGGACCTTCAGCGGACTTGTGCTGCCCGAGGCGTCACCATCGTGCCGGAGTTGGAGGCTCCGGGCCAT
GCGCTCCCCATTGTTCAGTGGCGGCCGCAGCTGGGGCTGAGAAAGGACCTGAGCCAGCTCAACATCTCGCATCCG
GAGACGATACCGACTATCAAGATGATTTGGCGTCATTTCTTGCCCTGGTTTCACTCCAAAGTCGTCTCTATAGGG
GCTGATGAGTACACGGGGCCGGTCAATGACTACGGTCGCTTCGTCAACTCGATGAATGCCTTTATCCAGCAAGAG
TCTAACAAGACCAAGGCGGTGCGGATCTGGGGCACCTTTCCTCCAGATAAGAGACCGAGCTTCGTCAATGTAGAT
CGCGACGTCTCGATTCAGCACTGGAGTTACCACGAAGACAACCCTTACTACGACTTCATCCGCAACGGCTACTCC
GTCGTCAACTCCATGCACGACTTCTACGTCGTCAGCAAATGGGGCCATTACCCAAACACCCTCGACGCTGCCAGG
ACCTTTGATGGCAACCCCAATGGCAAGGAGCCGTGGTATCCTCACATCTTCAACTTGCACAAGGCGTCTGACAAT
GCACGACGCGACGAGCCTCTCGTCATTGGCGCCATCACGCCCCTATGGAACGACTACGGGCCCAATGCCAGTGTC
TACTCAGAAGCCTATTACGCCTGGCGCCGAGGCTTGCCCGCCCTGGCTGATAAGCAATGGGGCGGACGGCTGACG
TCGAGGCAGTTCGATCGCCTCTTCACCGACCTCTATCCTCACGCACCGGCTCAGAACCTAGAGAGGAGGATCCCG
TCCAAGGGGGATGTCATATTCGAGTACGATCTCAGCCAGATGGTCTCGAGCACGAGCAATACCATCAAGGATCTC
TCACCCAATGGCTACGACGCCATCACCAACTGCGCGCCCATGGACTCGTCTCTCCATATGACGCCGAAATGCGAG
CTGAAGACGCCCTGGAGTTCCAAGGGAAGAGACTACACCCTGACCGTGAAGCTCAAGATCGAACGTCTCACCGAT
TCCGGAAACACGACGCTCCTCGTCGGCGCAGACTCAGTCCTGATGCTCACGCCCACCATCACCCTCTTCGCATCC
GGAACCTACCACCACCTGAAACTCTACTTCCCCATGGGTGAATGGATCGAGTTGAGTCTACGGGGTCGCGGGAAC
CAGACGTTCATCTCGCTCGAGCGTATGAGGGACAAGGTCGCCATGGGAGAGGAAGAGTTTCGCGTGGTAATGGGC
ATCGACGGTGAGCGCCTTCACTCGGATGTTGTGGCCATAGAGGCCCCCATAGAAAAGGTAACGGGATGGAGAGGC
CAGTTACGAGGCTTGCGGTTGACGCGGAGGGCGTAGCTGGAGATCCGATATCGCAGGGCCGCATCTGCCAGTGTA
ACGCTGGGAGGCTGTTTGCCCGCCACTGCAGATAGGTTTGGATACATACACGTCATTATGCCATTGCTCGACTTC
TTCTCTGGCTACGTGTAGATGGGAGAAACTTTGTCTCTTCTCCCAGGGTGAATTGAACTGAGGTTTGCATCTCAC
GATGCCTGTTGCTGTTGACGAGCAGAGTTTCGAAGCGGACGACGATGCACAGCTTCTACCGCCTACAGACACCGG
TCGAGGGGCGTACGTGGCTCTCGCGTGCTGCACCGTCTCCCAAGCTCCCATCTGGGGTGAGCTCCTCAAGCAGAT
ATACCACTACCAGACACGCTGCTAAGTGGCAGGCTAGGATACTCGGTCTCGTTCGGCATCTTTCAAGAATACTAC
AGCAACGACAGCGGCATCCCCGGCTCTCCCGGGGCCTTTGCCTCTATAGGCGCCGCTCAGGTAGGCGTCATGTAC
CTCCTGATGCCCGTCATCTTCGTCCTCCTCTACCGGAGACCGCGATGGCGCCCCTGGTGCGGAAGACTGGGCCTG
CTCATCACCATGGCCAGCATCTCGGCCTCGGCCTTCGTCTCGACTGTTCACGGCCTCATCGTTACTCAGGGGGTT
GTCTATGCTCTCGGCTGCGCGCTGCTCTTCAGCCCCGTCTCCGTCTATATGGATGAGTGGTTCGTTCGCTTCAAG
GGCGCGGCCTACGGTGTCATGTGGGGAGGGAAGTCGGCTGTTGGTGTTGGCATGCCCTTTGTTTTCAGTGCCATG
CTGAGCCGCTTTGGTTTGAGGATCACGCTTCTCTCCTGGGCTGTTGCTTCTGCGTTGTTGACGCTGCCGGCTCTC
GTTCTCATGAAGCCTAGGCTGCCTCTGCCCGCTGCTGGCGACGTCCGTGGCTCCCGGCCGCTGTCCTGGCGCTTC
ATCCGCTGTACCGTCTTCTGGATGATGCAGTTGGGCGTCGTGATACAGTCGCTGGGCTACATGATGCCCTCTACG
TATCTGGCCAGCTACGCCTTGGCCATCGGCTTGCCTCCAGTCACGGGGCCGCTGCTCTTGGCTGCCTTCTCGTTG
GCTTCGGTGCCCGGTTCCATCATCCACGGATTCCTCGGCGACAAGGTGTCTGCCAGCAAGGCCATCTTGATGTCT
TCGTTCGGAAGCGCCCTGCCCGTCTTTCTGCTCTGGGGGCTGAGCCTTCACTTTGCAAATGTCATGGCCTTTGCC
CTCGCTTTTGGCTTCTTTGCCGGTTTGTCACAGCTACGAAGCCGACTCCTGAGCTCTGTTGTGCTGATGCTTCTT
AAAAAGGGGGTTTCAGCTCTACCTGGTCGGGAATGGTCAACGAGATCCAGAAAGTCGACGCCAGTGCCGAATCGT
CTATTGTCTTTGGCATGCTTCTCGGCGGTCGAGGACTGGGCTTTGTTTTGAGCGGTCCCGTCAGCGGAGCTCTGC
TTTCAACGCGGTCGAGGCTGATGGACGGGACACTGGGATACGCTACTATCTATGGCCCAATGATCATCTTCACCG
GCACCACGGCGGTCTTGGGTGCCTGGGGGGCTTATTGTATTATCGCTGAGGCGGCAATGCTGTCTTGGTGTGCAC
GTCGGGATGCACTGCGTCTGGAGGACGATCTTGAAACCGAGAGATCGGCTTGAAAGCATCAGAGGTTTGGTCTAG
CAAACGTCATTGTCCTCTGATGCCGAACAGATCTGCGGTGTAAGTTCCCGGGTGAGACACGTGTAAGCCGGGACG
GGTGCGGTTTCAGCGACTCTCAGGCCTCGATGGATGTTTTTGTTGCGTGACAGCAGCTTATGGTGACACAAGTCC
ACATGCACATACATTTATTGACCCGATGGCTCTGGATGAACTGTGTCCGCATTCTGAAATAGAAGCATCTACCTA
GACAACTGGAACGTCTCAAAGTCGTTCTGTCGACTGTCCAGATCCAAAAGTCGGTGGCCGGTCACGAATCGTAGA
CCCGTCACCCCGGCCGAGACACAGTCTATGTCCTTTCAATCTTAACCCGTGATTCCGCTATTTCAGTCCAAGCTG
CTGTGCTTATCCGAAACAGAGTCCGGGCACTACGTGTAGCCTGCTCAACTGCCAACTTTTGAGGCAAAGGCGCCT
GGCTCTGCAGTCTTGTAAGTACTTGCATGTTACGAACAGTTCAATCATATCAGACCCATCAGTGAGCCCTGGATC
GATCATCGAATATGCCATTGCTCCCAAGACGTTTCCATTCGGACAGCATTCCATCCAGATAAACAAGGTGAGACA
GTGTTCTAAACCCACCGCTAAAACCGCAGTCGGTAGGGCAGTTTCTGAGCATAGCCCCGTGTCCTGCTCTTCTGA
CGGCGTATCACGGCGGTGTCGAGGCCTGAGTCTCGCCTTGGCCTAGATCAACAGCTTACCTCGGGTGAGCAACGG
GGTTTAATAAGGGCCCGGCGAGCAGGACTCCTTACATGGAGCCAACGACAGAAAGAATTCACAACACAGATGAGG
ACCTTTCAAGCCTTCACCATTGCTCTGGTCGCCAGCACCGCCGCCGCTGCGGCTGACACGATGCTAGGCTTCGAG
GCTTCGAGCGTCCATGGCGCCGTCGACTTTGGTCAGGCCTACGCTGATGGAGCTCGCTTCGCCATCATCAGGGCC
AGCTCTGTCAGCTACTCCTCATGTATCCGTAAGACTCTAGACTAATGGAGACGAGCGAAGACGACAGGAGGCTCT
AGTCATGTAGACCGCACATTCAGGCAATTCCAGCAACAAGCCGCAGACGCAGGTCTAATCCGCGGGGGATACCAC
GTCGGCCAGCCGGAGAGGGCCTTTGGCGGCATCCAGGCCAAGTACTTTCTCCAGAACGGCGGCGGCTGGATTAAC
GACGGCATGACGCTGCCCGGAATGATGGTCTTGACGGATAGAGACCACCGGGAGACACGAACGTGCTACGGCATG
ACGCCCAAGGAGATTCAGCGCTGGATCATCGAGTTCACCGAAGTCTACCGCGCCTCGACGAGCATCTACCCGATG
TTGTACACCACGACGGGCTGGTGGAAGCAGTGCACCGGCAACACGATTAATCTCATGAACCGCGCTCTGCTCGTC
GTCTCGGATCACGGTGACAGGCTCGGTGAGCTGCCGGCGGGCTGGAAGAAGCACACATTCTGGGAATATTCAGCC
AGTTCTCCTTGGGCGGGCGGGTCGTATGTCTTTAACGGCGACGAGGCGGGACTCAATAGGACGGCTGTGGTTGGG
CGTCCGGATTAGCGGGCTCAGGAGGCGGTTTGTCGTGTAAGTAGGCTGCTTTGAAGCCGATGCTGGAGGTTTGTA
TAGCAGGGACATGAATCCATGATGTATGCAGAGAGAAGAGAGAGAAGCACCCTTAGATATGAATATACGACAAGA
TTGGGTGATCCATGCAGTCATTCAACATGAGGGAGTGATGACGGGCTCTTCGCACTGTGATTCGGTGGCAATAAT
CGTACTTATGAATGCTTCATCGCCGCTCTCCCAAGATTATACATATGCACACACACGTCACCGGCTTCCACTACA
AGTATTCATCTCATCCGCAACCCTCCAAGCCCCATGACTCCCGACGACAACTGCTACAAGCCCAATGCTTCCCGC
TCAGCTACTCCGTCCCCTGTCCGTCCGCCATCTCACCCCCCGAGCGCGACACCTCAGCACCGCAGCAGCAGACAT
CGCCTCCCTCCTCTCCCAAAAGCTCGCCCGCTCAACGACAGTCCATCGCCAGAAGCTCGACGCAAACCAGCTGCA
GAAGCTCTGTCTGACGCTCGGAACCCCTCGTCTCGGGGACGTCGACGTCTCGCTCCGGCCGCCTCCGGATGGATC
CCCCGTTCCCCCGGGCTATCATCTCGTCTACTTCACCCCTCTCGTTCCCGAGTCGAGCCTCGGTCCGGACGGGAG
TGACGCTACCTTTAATGCTCCGGCTCCGTTTACTAGGCGGATGTGGGCGGGAGGGACCATGTCCTGGTCGGGCGA
CGCGCTCCGTGTAGGGGACGAGGTTGAGGAGCGGACGAGGCTGGTGAGGGCTACGGCGAAGGAGGGCTCCAAGGG
AGATATGATTCTCGTCGACGTAGAGAAGGAGTTGGTGTCTTCTCGAGGCTGCTCGGTGGTTGATCGACGAGCGTG
GATCTTCCGGCCCGGGCTGAGCACTCCGGTGATGCCGGTCACGTCGTCTTATAAAGGCCAGGCTACGGTGGAACA
AGGGCAACCGGAAGAGGGTGAGTTCTCTCAGATGATGCTATATGACTTCAATGATGTAACCGCTCACCTCTCCCA
GACCAGCTCAATCATGTTCCAACCCGTAGCCTCTCCTGGTCCCAAACAGCCCTATTCCGATTCTCAGCCCTCACC
TTCAACGCACACAAAATCCACTACGACAAAGACTGGTGTCAAAAGGTCGAGGGCCACCCATCGCCCGTCGTCCAC
GGGCCGCTGACGTTGCTCTCCATGCTCGACCACTGGCGCGACGTTCACGGCTCGGGAAAGCAGCTGCTCTCCATC
GACTATCGCGCCCTGAAGCCGGTATATGCTGGCGAAACGTACCGCGTTAGGACGGGGAGTTGTGAGGAGGTTGTG
GCGGAGAAGAACGGGGTCGTCTGCATGCGAGCCGAGCTTCAATCACGCAGCTTGGGTGCTTAAAAGCCGCGAGAA
TTATGTCTCGTTTATGTATTCGTAGTTATGCCGCCTCGACGTGAGATAAATACCGCATCCCCCCGCAGCAAGCAT
GAACCGAGGTAACTTGAGCTCCTAGTCATGTCTACTGTGAGGATCATGGCTTCTCGCAGAATGGCAACGAGACAG
GTACTGCCGTCATGGAAATACGTATGCTAGACGTTGGCTAATAAATAGGCAAGCTCGTGTCGAGACGGCATATAA
GATGGCTCAGCCTCCAGGAGCATCAATCGCAAAAGATGCTCAGCCAAGTAAAGAATGCTCAGGGTCCACCGTCTT
ACACTGCCTCTAACAGATGCAGCTTGGCATCAGGACTCCGCGGACTAGGCTCGTTGGGTCTGTGGATGAGGCTCG
GGACGCCATCAAGGAACTGGGTAGGTTGCATTTCGGCTCCCATTTACACATTACACAAGGCGGAACAAGTGGAAG
CTGATCTCGTAAAGGCATCCCGTGTATCTTCGCAGTAGAAAAGCAAGGTCGACAAGGCGCCTTTGGAAGCGGCTC
ACCAGCGGACCATAAGCTGATAGACACCGTCGACAAGGCCACAGCAATAGCATCGCAGATTCTCAACCGCCGAAG
CTCCAACCAAGACAGTTCCCTCATAATGAGCCAGCTGCGCGTGACAGAACACATCCAATCCGATGCAAACTGGTA
TCTCGCCATATCTATCAACAGAGAGAGCTACGGACCGGCCATAACCATTTCGAGGCGAGGCGGCATGACCATCGA
TGAGATAGCCAGGGTCTACCCCGACAGCCTCTACACCTTTCCCTTTACTCTCTCAACCGGCATCACGACAAGCCT
CATGTCACAAATACAAACACAACTCCAGCTATCAAGCGTCCAATCCAGCAGTCTCAAGCACCTCCTACACCAAGC
ATTCACCGTCTTCTCCAAGAAAGACGCGACCCTCTTCGAAATCAACCCAATGACCATGTCAAAAGACGGAAGCAT
AGCCAGCCTCAGCACAAACCTCCTCATCGACGACGCCGCAAAGAAGCGCCAGCCGGAACTATCGGCCCTCCGGGA
TAGAAGCCAAGATGTCGCGGAAGAAGTCGAGGCGGAGAAGCACGGCTTGGTATACGTCAAGATGGAGGGAGACAT
TGGCATCGTCGTCAATGGGGCTGGACTGGCGATGGCTACCAACGATGCCATTGGCTCTCACGGCGGGAAGAGCGC
AAACTTTCTTGATACGGGTGGGAAGGCGACTACGGAGACGATGATGAAGGCATTTGAGATTGTGACGCGGGACGA
GAGGGTCAAGGCTATCCTCGTCAACATCTACGGGGGTGCGATCCAGCCCCGATATTCCCCCTTTATATCTTGAAA
AGAACGAGCTGACAGGTCGACGTCCAACAGGCCTCACCCGCTGCGACATGATTGCCCAGTCCATCATCGGCGCCG
CGCGGGGGCTGGACGTGCGGGTGCCGATGGTGGTTCGGCTTCAGGGGACCAACTCGGAGCAGGGTCTCAAGATGG
TGAGTCCATTGTTTGTTCGGTTGCCTGTTGACTGTTACTGACGGTGTGAAAGCTCGAGGAGGCCGACTTGGACAT
CGATATGGTGGTTGAGTCGGACTGGCGGGCGGCACGGCGGGTGGTAGAGCTGGCAAGGGGAGCTGAGTCTACGAA
TACATGCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail