Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3591
Gene name
LocationContig_32:25212..26087
Strand-
Gene length (bp)875
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09428 DUF2011 Fungal protein of unknown function (DUF2011) 1.2E-20 90 171

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1665
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6670
Ophiocordyceps australis map64 (Brazil) OphauB2|4166
Ophiocordyceps camponoti-floridani Ophcf2|02556
Ophiocordyceps camponoti-rufipedis Ophun1|3591 (this protein)
Ophiocordyceps kimflemingae Ophio5|986
Ophiocordyceps subramaniannii Hirsu2|1411

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3591
MFDLPEAKRIRREDLEASDEESHNDVEKKLDTALRESLQARLAKSLGELLPHAKPANEVDDERPISAASSAGAAI
ASCARDQEDEVLGEFEFRLFSTAGSVPKITLNVDDRIDGEGNIVAKRPQSYYLATNIPEQLRREYEMACVSGDDV
VARSRCRSWGLELPWKVTTITTVKKSILEDETTKDSVANTQTAKKKRPGKKTRIAQRKRERAARDREQLAAKQEM
DKSEHLQNKKMRLNRTKKLRRRAKDKEKRLAAVTGDAHGAGPGDESGESN*
Coding >Ophun1|3591
ATGTTTGATCTGCCAGAAGCCAAAAGGATTCGACGTGAGGACCTCGAAGCCTCGGATGAAGAAAGCCATAATGAC
GTCGAGAAAAAGCTTGATACCGCTCTGAGAGAATCTTTGCAGGCCCGGTTGGCCAAGTCTTTGGGCGAGCTCCTC
CCCCATGCGAAGCCCGCGAACGAAGTCGACGATGAAAGGCCAATATCAGCCGCATCGTCAGCTGGTGCTGCTATA
GCTTCTTGCGCACGCGATCAAGAAGACGAAGTTTTGGGCGAATTCGAATTTCGGCTTTTCAGCACGGCGGGATCC
GTGCCCAAGATCACCCTCAACGTCGATGACAGGATAGATGGAGAGGGCAATATCGTGGCCAAGCGACCGCAATCA
TATTACCTAGCCACGAATATACCTGAACAGCTACGACGGGAATACGAGATGGCTTGCGTTAGTGGCGACGACGTC
GTGGCTCGATCACGGTGCAGGTCCTGGGGTCTCGAATTGCCGTGGAAGGTGACTACGATTACTACCGTCAAGAAG
TCGATACTGGAGGACGAAACAACGAAAGACAGCGTCGCCAATACCCAGACAGCAAAGAAGAAGCGCCCGGGAAAA
AAGACGAGGATCGCACAGCGGAAACGGGAGAGAGCGGCGAGAGATCGCGAACAGCTGGCGGCCAAGCAAGAAATG
GACAAGAGCGAGCACCTACAAAACAAAAAGATGAGACTAAATCGGACCAAGAAGTTGAGAAGGCGGGCCAAGGAC
AAGGAGAAGAGACTGGCGGCGGTTACGGGGGATGCTCACGGAGCTGGTCCGGGCGATGAGTCGGGCGAGTCGAAC
TGA
Transcript >Ophun1|3591
ATGTTTGATCTGCCAGAAGCCAAAAGGATTCGACGTGAGGACCTCGAAGCCTCGGATGAAGAAAGCCATAATGAC
GTCGAGAAAAAGCTTGATACCGCTCTGAGAGAATCTTTGCAGGCCCGGTTGGCCAAGTCTTTGGGCGAGCTCCTC
CCCCATGCGAAGCCCGCGAACGAAGTCGACGATGAAAGGCCAATATCAGCCGCATCGTCAGCTGGTGCTGCTATA
GCTTCTTGCGCACGCGATCAAGAAGACGAAGTTTTGGGCGAATTCGAATTTCGGCTTTTCAGCACGGCGGGATCC
GTGCCCAAGATCACCCTCAACGTCGATGACAGGATAGATGGAGAGGGCAATATCGTGGCCAAGCGACCGCAATCA
TATTACCTAGCCACGAATATACCTGAACAGCTACGACGGGAATACGAGATGGCTTGCGTTAGTGGCGACGACGTC
GTGGCTCGATCACGGTGCAGGTCCTGGGGTCTCGAATTGCCGTGGAAGGTGACTACGATTACTACCGTCAAGAAG
TCGATACTGGAGGACGAAACAACGAAAGACAGCGTCGCCAATACCCAGACAGCAAAGAAGAAGCGCCCGGGAAAA
AAGACGAGGATCGCACAGCGGAAACGGGAGAGAGCGGCGAGAGATCGCGAACAGCTGGCGGCCAAGCAAGAAATG
GACAAGAGCGAGCACCTACAAAACAAAAAGATGAGACTAAATCGGACCAAGAAGTTGAGAAGGCGGGCCAAGGAC
AAGGAGAAGAGACTGGCGGCGGTTACGGGGGATGCTCACGGAGCTGGTCCGGGCGATGAGTCGGGCGAGTCGAAC
TGA
Gene >Ophun1|3591
ATGTTTGATCTGCCAGAAGCCAAAAGGTTCGATTCTCTCCCTCTTCAGTCTCGCACCCAGCTGATGGCAAAAGGA
TTCGACGTGAGGACCTCGAAGCCTCGGATGAAGAAAGCCATAATGACGTCGAGAAAAAGCTTGATACCGCTCTGA
GAGAATCTTTGCAGGCCCGGTTGGCCAAGTCTTTGGGCGAGCTCCTCCCCCATGCGAAGCCCGCGAACGAAGTCG
ACGATGAAAGGCCAATATCAGCCGCATCGTCAGCTGGTGCTGCTATAGCTTCTTGCGCACGCGATCAAGAAGACG
AAGTTTTGGGCGAATTCGAATTTCGGCTTTTCAGCACGGCGGGATCCGTGCCCAAGATCACCCTCAACGTCGATG
ACAGGATAGATGGAGAGGGCAATATCGTGGCCAAGCGACCGCAATCATATTACCTAGCCACGAATATACCTGAAC
AGCTACGACGGGAATACGAGATGGCTTGCGTTAGTGGCGACGACGTCGTGGCTCGATCACGGTGCAGGTCCTGGG
GTCTCGAATTGCCGTGGAAGGTGACTACGATTACTACCGTCAAGAAGTCGATACTGGAGGACGAAACAACGAAAG
ACAGCGTCGCCAATACCCAGACAGCAAAGAAGAAGCGCCCGGGAAAAAAGACGAGGATCGCACAGCGGAAACGGG
AGAGAGCGGCGAGAGATCGCGAACAGCTGGCGGCCAAGCAAGAAATGGACAAGAGCGAGCACCTACAAAACAAAA
AGATGAGACTAAATCGGACCAAGAAGTTGAGAAGGCGGGCCAAGGACAAGGAGAAGAGACTGGCGGCGGTTACGG
GGGATGCTCACGGAGCTGGTCCGGGCGATGAGTCGGGCGAGTCGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail