Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|359
Gene name
LocationContig_11:36843..40346
Strand-
Gene length (bp)3503
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 1.1E-40 765 1006
PF01974 tRNA_int_endo tRNA intron endonuclease, catalytic C-terminal domain 2.1E-17 364 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Y2|SEN2_NEUCR Probable tRNA-splicing endonuclease subunit tsp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-2 PE=3 SV=1 3 488 3.0E-132
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 651 1015 3.0E-31
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 300 488 8.0E-26
sp|Q5ZIN2|SEN2_CHICK tRNA-splicing endonuclease subunit Sen2 OS=Gallus gallus GN=TSEN2 PE=2 SV=1 78 488 1.0E-25
sp|Q98KK0|BODG_RHILO Probable gamma-butyrobetaine dioxygenase OS=Rhizobium loti (strain MAFF303099) GN=mll1440 PE=3 SV=1 651 1014 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Y2|SEN2_NEUCR Probable tRNA-splicing endonuclease subunit tsp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-2 PE=3 SV=1 3 488 3.0E-132
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 651 1015 3.0E-31
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 300 488 8.0E-26
sp|Q5ZIN2|SEN2_CHICK tRNA-splicing endonuclease subunit Sen2 OS=Gallus gallus GN=TSEN2 PE=2 SV=1 78 488 1.0E-25
sp|Q98KK0|BODG_RHILO Probable gamma-butyrobetaine dioxygenase OS=Rhizobium loti (strain MAFF303099) GN=mll1440 PE=3 SV=1 651 1014 1.0E-24
sp|Q19000|BODG_CAEEL Probable gamma-butyrobetaine dioxygenase OS=Caenorhabditis elegans GN=gbh-1 PE=3 SV=1 717 1016 2.0E-24
sp|P23180|AIM17_YEAST Probable oxidoreductase AIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM17 PE=1 SV=2 741 1015 9.0E-24
sp|Q5R5D8|BODG_PONAB Gamma-butyrobetaine dioxygenase OS=Pongo abelii GN=BBOX1 PE=2 SV=1 617 1015 1.0E-22
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 651 1019 3.0E-22
sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens GN=BBOX1 PE=1 SV=1 617 1015 5.0E-22
sp|Q9QZU7|BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus GN=Bbox1 PE=1 SV=1 763 1015 1.0E-21
sp|Q6P7W5|SEN2_MOUSE tRNA-splicing endonuclease subunit Sen2 OS=Mus musculus GN=Tsen2 PE=1 SV=1 302 488 2.0E-21
sp|Q924Y0|BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus GN=Bbox1 PE=1 SV=1 763 1015 3.0E-21
sp|Q5M954|SEN2_RAT tRNA-splicing endonuclease subunit Sen2 OS=Rattus norvegicus GN=Tsen2 PE=1 SV=1 302 488 4.0E-21
sp|Q8NCE0|SEN2_HUMAN tRNA-splicing endonuclease subunit Sen2 OS=Homo sapiens GN=TSEN2 PE=1 SV=2 302 488 5.0E-21
sp|P16658|SEN2_YEAST tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 297 488 1.0E-20
sp|Q74ZY5|SEN2_ASHGO tRNA-splicing endonuclease subunit SEN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN2 PE=3 SV=2 283 489 5.0E-20
sp|Q9NVH6|TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens GN=TMLHE PE=1 SV=1 589 1022 7.0E-18
sp|Q0VC74|TMLH_BOVIN Trimethyllysine dioxygenase, mitochondrial OS=Bos taurus GN=TMLHE PE=2 SV=1 747 1022 2.0E-17
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 747 1016 2.0E-16
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 752 1016 1.0E-15
sp|Q5F4B3|TMLH_CHICK Trimethyllysine dioxygenase, mitochondrial OS=Gallus gallus GN=TMLHE PE=2 SV=1 747 1022 1.0E-14
sp|P16658|SEN2_YEAST tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 17 152 2.0E-12
sp|Q5Z6B1|SEN2_ORYSJ Probable tRNA-splicing endonuclease subunit Sen2 OS=Oryza sativa subsp. japonica GN=Os06g0530700 PE=2 SV=1 278 449 4.0E-12
sp|Q9M1E8|SEN21_ARATH tRNA-splicing endonuclease subunit Sen2-1 OS=Arabidopsis thaliana GN=SEN1 PE=2 SV=1 263 492 4.0E-11
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 22 151 1.0E-10
sp|Q9LSS3|SEN22_ARATH tRNA-splicing endonuclease subunit Sen2-2 OS=Arabidopsis thaliana GN=SEN2 PE=2 SV=1 262 489 1.0E-10
sp|Q74ZY5|SEN2_ASHGO tRNA-splicing endonuclease subunit SEN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN2 PE=3 SV=2 25 152 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0000213 tRNA-intron endonuclease activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0008380 RNA splicing No
GO:0004519 endonuclease activity No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016892 endoribonuclease activity, producing 3'-phosphomonoesters No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004549 tRNA-specific ribonuclease activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0004521 endoribonuclease activity No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004540 ribonuclease activity No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016894 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters No
GO:0004518 nuclease activity No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0008033 tRNA processing No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0034470 ncRNA processing No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2592
Ophiocordyceps australis 1348a (Ghana) OphauG2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|1721
Ophiocordyceps australis map64 (Brazil) OphauB2|1722
Ophiocordyceps camponoti-floridani Ophcf2|05298
Ophiocordyceps camponoti-floridani Ophcf2|05299
Ophiocordyceps camponoti-rufipedis Ophun1|359 (this protein)
Ophiocordyceps kimflemingae Ophio5|2368
Ophiocordyceps kimflemingae Ophio5|2369
Ophiocordyceps subramaniannii Hirsu2|2316
Ophiocordyceps subramaniannii Hirsu2|2317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|359
MAEVNASSNGRASLPRRGPSIHQIYSLPAPIRTFPLPTFYPDNPLSLLHVASAWLSQLFRPPPAEPAVIHCGVWS
EESTSVHVKDEKSMRALWEQGFYGKGNLSRSEPNWAKRERVLRGLQDVHVSELLTLQRRQERAEAKWERARLEQE
AIRNTKLQEARQEAARRQAESKNSSHTAPVGPLELLSLPNSHLNMSLVGPVSESGPEVVGEPRSEKQIETLAVGH
AAAEGAAHDNQLISKSGECSETSSDSTSVKRQKSVRFSPKVESTTFQLSDPPSPNHASAANSSSPIDNAEEELVN
QEHLQLMPEEAFFLCFGLGALRVTEPDSDEALSTRQMLTRFRQYSYVPPRIGPDEPDLEADDAFLVHYAVYHHFR
SLGWVPRAGIKFGVDWLLYARGPVFDHAEFGIIVIPSYSDPWWERSGIGKSWAWLHGVVRVLSHVMKSLVLVYVD
VPPTPRFEEALAVDVGEAMKLYRVREVMVKRWSSNRNRKISTAGGNSSIQRIVSRTASGRFPSQPPTSFPRRIPK
YLERFRYRLPSVNADGEEEAGCEMPISARSDYEDKERRKTQPDPTPTPIARPGSISQLKRPSQNLDDEVQDMPDV
FELTPAAREPKPLATASIDTRPVVTIAWVTDKLYIEDEQRSLVKELRPAAIRDNCVCRLCRDADSGNKLFESSQI
PTDIAIESARATDDGLWVKLMNDTPGHDETLVPWEQVEVALRRRGAREGFFPRRPSILGQTGMLCWDRDTLQSVV
RAIDYEAFMSGHDDDAALWDVIIDLCRLGIVFIRGLPTDLGAVEEVTTRIANLRETFYGRVFDVTAGAADSASNV
AYTSRALGLHQDLLYLDPPPQIQVLHCLDNSCPGGDSFFSDSERVARLLWPFVRVSERLSPLATRSVDYHYRGYD
YREPPFRHHFYHASRPVLSHDALTGFTRVWWSPPFQAPSQLADQQLQPWIRAARFFEELVSDPEAVFRVRLQPGD
CVLFDNRRVLHGRDAFDATASGCKRWLRGAYIAADDFWSRASQMPAQQAEYYRGPELWSSMMENQDLRHSQWRKR
VEQMVMRFDPGVDERMVR*
Coding >Ophun1|359
ATGGCTGAGGTCAATGCTTCGTCCAACGGGAGAGCTTCGCTTCCGAGGCGGGGGCCTTCCATCCATCAGATATAC
TCGCTGCCCGCCCCCATTCGTACCTTTCCTCTTCCGACCTTTTACCCCGACAACCCTCTGTCGCTGTTGCACGTC
GCCTCGGCATGGCTGAGCCAGCTCTTTCGCCCGCCTCCCGCCGAGCCAGCCGTCATCCACTGCGGCGTGTGGTCT
GAGGAGTCCACTTCTGTCCACGTCAAGGATGAAAAGTCGATGCGCGCTCTCTGGGAGCAGGGCTTCTACGGCAAA
GGCAACCTGAGCCGTAGCGAGCCCAACTGGGCGAAGCGGGAGCGCGTTTTGAGAGGGCTGCAAGATGTTCACGTC
AGTGAGCTTTTGACCTTGCAGAGGCGTCAGGAGCGTGCAGAGGCAAAGTGGGAGCGGGCGAGGCTGGAGCAGGAA
GCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCAAGCTGAATCAAAGAATTCGTCT
CATACGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCACATCTCAACATGTCACTGGTCGGGCCG
GTCTCAGAGAGCGGTCCTGAAGTCGTCGGCGAGCCCAGATCTGAAAAGCAGATTGAAACACTAGCCGTCGGTCAC
GCAGCCGCTGAGGGGGCGGCGCACGACAATCAGCTCATCAGCAAGTCCGGCGAATGCTCCGAAACCTCGAGCGAT
TCTACTTCGGTGAAACGCCAGAAGAGCGTGCGATTCTCTCCAAAGGTAGAGTCGACGACATTCCAACTGTCCGAT
CCTCCGAGCCCCAACCACGCGTCGGCCGCCAACAGCAGCAGCCCCATTGATAACGCGGAGGAGGAACTGGTCAAT
CAAGAGCACCTCCAGCTCATGCCCGAGGAGGCCTTCTTCCTGTGTTTCGGGCTGGGGGCCCTCCGCGTTACGGAG
CCCGACTCTGACGAGGCTCTGTCGACTCGGCAAATGTTGACACGCTTCCGGCAGTACTCGTATGTTCCGCCGCGG
ATCGGACCAGACGAGCCGGACCTGGAAGCGGACGACGCATTCCTGGTACATTACGCCGTCTATCACCACTTCCGC
TCGCTCGGCTGGGTGCCGCGAGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGTATGCCAGAGGGCCCGTGTTT
GATCACGCCGAGTTTGGCATCATCGTCATCCCATCGTACTCGGACCCGTGGTGGGAGAGGTCGGGCATTGGCAAG
TCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAC
GTGCCGCCGACGCCGAGGTTTGAGGAGGCTCTGGCGGTGGACGTTGGGGAGGCGATGAAGCTGTACAGGGTGAGG
GAGGTGATGGTGAAGCGGTGGTCGAGCAATCGAAATCGAAAGATCAGCACGGCTGGCGGCAACAGCAGCATCCAG
CGCATCGTCTCCCGCACAGCTTCGGGCCGGTTCCCAAGCCAGCCGCCGACCTCGTTCCCTCGACGGATCCCAAAG
TATCTGGAGCGGTTCCGGTACCGTCTTCCCTCGGTAAATGCCGACGGCGAAGAGGAGGCTGGCTGCGAGATGCCC
ATCAGCGCCCGCAGCGATTATGAGGACAAAGAGCGGAGGAAGACTCAGCCCGATCCGACCCCGACTCCCATCGCC
AGACCGGGATCGATATCCCAGCTCAAGAGGCCAAGCCAAAATCTCGACGACGAGGTTCAGGACATGCCAGACGTC
TTCGAGCTGACGCCGGCAGCGCGCGAACCAAAGCCCCTCGCGACGGCTTCCATCGACACTCGGCCGGTGGTGACG
ATAGCTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTAAAAGAGCTTCGGCCGGCGGCG
ATCCGCGACAACTGCGTTTGCCGGTTATGTCGAGACGCCGACTCGGGTAACAAGCTGTTCGAGTCGTCGCAAATT
CCCACCGACATCGCTATCGAGAGCGCGCGAGCCACCGACGACGGGCTCTGGGTGAAGCTCATGAACGATACGCCC
GGCCACGACGAGACGCTGGTGCCGTGGGAACAGGTCGAGGTGGCGCTGCGTCGACGGGGGGCTCGTGAGGGCTTC
TTCCCACGGCGGCCGTCGATATTGGGCCAGACGGGGATGCTATGCTGGGATCGGGACACGCTGCAGAGTGTTGTA
AGGGCCATCGACTACGAAGCCTTCATGTCAGGACATGACGATGATGCCGCCCTCTGGGACGTCATCATCGACCTC
TGCCGGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGATCTCGGGGCTGTCGAGGAGGTTACGACGCGGATT
GCGAACCTGCGCGAGACGTTTTATGGGCGCGTCTTCGATGTCACGGCTGGAGCAGCGGATTCAGCCAGCAACGTG
GCCTACACCTCGCGAGCGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCGCCGCCCCAGATCCAGGTGCTT
CACTGCCTCGACAACTCGTGCCCCGGCGGCGACTCCTTCTTCTCCGATTCGGAGCGCGTGGCGCGTCTGCTGTGG
CCGTTTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTCGACTACCATTACCGCGGCTACGAC
TACCGCGAACCTCCCTTCCGTCACCACTTTTACCACGCCAGCCGGCCGGTTCTATCCCACGACGCCCTCACGGGT
TTCACGCGCGTCTGGTGGAGTCCGCCCTTCCAGGCGCCGTCGCAACTGGCAGACCAGCAGCTGCAGCCGTGGATC
CGAGCAGCCCGGTTCTTCGAAGAGCTCGTCTCGGACCCAGAGGCCGTCTTCCGCGTGCGTCTCCAGCCGGGAGAC
TGCGTCCTCTTCGACAACCGGCGCGTGCTGCACGGACGGGACGCGTTCGACGCCACGGCCAGCGGGTGTAAACGC
TGGCTTAGGGGCGCGTACATTGCTGCTGATGACTTTTGGAGCAGGGCTTCGCAGATGCCGGCTCAGCAGGCTGAG
TATTATCGGGGGCCGGAGCTGTGGTCTAGCATGATGGAGAATCAGGATTTGAGGCATTCGCAGTGGAGGAAAAGG
GTTGAGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGGTAG
Transcript >Ophun1|359
ATGGCTGAGGTCAATGCTTCGTCCAACGGGAGAGCTTCGCTTCCGAGGCGGGGGCCTTCCATCCATCAGATATAC
TCGCTGCCCGCCCCCATTCGTACCTTTCCTCTTCCGACCTTTTACCCCGACAACCCTCTGTCGCTGTTGCACGTC
GCCTCGGCATGGCTGAGCCAGCTCTTTCGCCCGCCTCCCGCCGAGCCAGCCGTCATCCACTGCGGCGTGTGGTCT
GAGGAGTCCACTTCTGTCCACGTCAAGGATGAAAAGTCGATGCGCGCTCTCTGGGAGCAGGGCTTCTACGGCAAA
GGCAACCTGAGCCGTAGCGAGCCCAACTGGGCGAAGCGGGAGCGCGTTTTGAGAGGGCTGCAAGATGTTCACGTC
AGTGAGCTTTTGACCTTGCAGAGGCGTCAGGAGCGTGCAGAGGCAAAGTGGGAGCGGGCGAGGCTGGAGCAGGAA
GCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCAAGCTGAATCAAAGAATTCGTCT
CATACGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCACATCTCAACATGTCACTGGTCGGGCCG
GTCTCAGAGAGCGGTCCTGAAGTCGTCGGCGAGCCCAGATCTGAAAAGCAGATTGAAACACTAGCCGTCGGTCAC
GCAGCCGCTGAGGGGGCGGCGCACGACAATCAGCTCATCAGCAAGTCCGGCGAATGCTCCGAAACCTCGAGCGAT
TCTACTTCGGTGAAACGCCAGAAGAGCGTGCGATTCTCTCCAAAGGTAGAGTCGACGACATTCCAACTGTCCGAT
CCTCCGAGCCCCAACCACGCGTCGGCCGCCAACAGCAGCAGCCCCATTGATAACGCGGAGGAGGAACTGGTCAAT
CAAGAGCACCTCCAGCTCATGCCCGAGGAGGCCTTCTTCCTGTGTTTCGGGCTGGGGGCCCTCCGCGTTACGGAG
CCCGACTCTGACGAGGCTCTGTCGACTCGGCAAATGTTGACACGCTTCCGGCAGTACTCGTATGTTCCGCCGCGG
ATCGGACCAGACGAGCCGGACCTGGAAGCGGACGACGCATTCCTGGTACATTACGCCGTCTATCACCACTTCCGC
TCGCTCGGCTGGGTGCCGCGAGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGTATGCCAGAGGGCCCGTGTTT
GATCACGCCGAGTTTGGCATCATCGTCATCCCATCGTACTCGGACCCGTGGTGGGAGAGGTCGGGCATTGGCAAG
TCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAC
GTGCCGCCGACGCCGAGGTTTGAGGAGGCTCTGGCGGTGGACGTTGGGGAGGCGATGAAGCTGTACAGGGTGAGG
GAGGTGATGGTGAAGCGGTGGTCGAGCAATCGAAATCGAAAGATCAGCACGGCTGGCGGCAACAGCAGCATCCAG
CGCATCGTCTCCCGCACAGCTTCGGGCCGGTTCCCAAGCCAGCCGCCGACCTCGTTCCCTCGACGGATCCCAAAG
TATCTGGAGCGGTTCCGGTACCGTCTTCCCTCGGTAAATGCCGACGGCGAAGAGGAGGCTGGCTGCGAGATGCCC
ATCAGCGCCCGCAGCGATTATGAGGACAAAGAGCGGAGGAAGACTCAGCCCGATCCGACCCCGACTCCCATCGCC
AGACCGGGATCGATATCCCAGCTCAAGAGGCCAAGCCAAAATCTCGACGACGAGGTTCAGGACATGCCAGACGTC
TTCGAGCTGACGCCGGCAGCGCGCGAACCAAAGCCCCTCGCGACGGCTTCCATCGACACTCGGCCGGTGGTGACG
ATAGCTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTAAAAGAGCTTCGGCCGGCGGCG
ATCCGCGACAACTGCGTTTGCCGGTTATGTCGAGACGCCGACTCGGGTAACAAGCTGTTCGAGTCGTCGCAAATT
CCCACCGACATCGCTATCGAGAGCGCGCGAGCCACCGACGACGGGCTCTGGGTGAAGCTCATGAACGATACGCCC
GGCCACGACGAGACGCTGGTGCCGTGGGAACAGGTCGAGGTGGCGCTGCGTCGACGGGGGGCTCGTGAGGGCTTC
TTCCCACGGCGGCCGTCGATATTGGGCCAGACGGGGATGCTATGCTGGGATCGGGACACGCTGCAGAGTGTTGTA
AGGGCCATCGACTACGAAGCCTTCATGTCAGGACATGACGATGATGCCGCCCTCTGGGACGTCATCATCGACCTC
TGCCGGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGATCTCGGGGCTGTCGAGGAGGTTACGACGCGGATT
GCGAACCTGCGCGAGACGTTTTATGGGCGCGTCTTCGATGTCACGGCTGGAGCAGCGGATTCAGCCAGCAACGTG
GCCTACACCTCGCGAGCGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCGCCGCCCCAGATCCAGGTGCTT
CACTGCCTCGACAACTCGTGCCCCGGCGGCGACTCCTTCTTCTCCGATTCGGAGCGCGTGGCGCGTCTGCTGTGG
CCGTTTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTCGACTACCATTACCGCGGCTACGAC
TACCGCGAACCTCCCTTCCGTCACCACTTTTACCACGCCAGCCGGCCGGTTCTATCCCACGACGCCCTCACGGGT
TTCACGCGCGTCTGGTGGAGTCCGCCCTTCCAGGCGCCGTCGCAACTGGCAGACCAGCAGCTGCAGCCGTGGATC
CGAGCAGCCCGGTTCTTCGAAGAGCTCGTCTCGGACCCAGAGGCCGTCTTCCGCGTGCGTCTCCAGCCGGGAGAC
TGCGTCCTCTTCGACAACCGGCGCGTGCTGCACGGACGGGACGCGTTCGACGCCACGGCCAGCGGGTGTAAACGC
TGGCTTAGGGGCGCGTACATTGCTGCTGATGACTTTTGGAGCAGGGCTTCGCAGATGCCGGCTCAGCAGGCTGAG
TATTATCGGGGGCCGGAGCTGTGGTCTAGCATGATGGAGAATCAGGATTTGAGGCATTCGCAGTGGAGGAAAAGG
GTTGAGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGGTAG
Gene >Ophun1|359
ATGGCTGAGGTCAATGCTTCGTCCAACGGGAGAGCTTCGCTTCCGAGGCGGGGGCCTTCCATCCATCAGATATAC
TCGCTGCCCGCCCCCATTCGTACCTTTCCTCTTCCGACCTTTTACCCCGACAACCCTCTGTCGCTGTTGCACGTC
GCCTCGGCATGGCTGAGCCAGCTCTTTCGCCCGCCTCCCGCCGAGCCAGCCGTCATCCACTGCGGCGTGTGGTCT
GAGGAGTCCACTTCTGTCCACGTCAAGGATGAAAAGTCGATGCGCGCTCTCTGGGAGCAGGGCTTCTACGGCAAA
GGCAACCTGAGCCGTAGCGAGCCCAACTGGGCGAAGCGGGAGCGCGTTTTGAGAGGGCTGCAAGATGTTCACGTC
AGTGAGCTTTTGACCTTGCAGAGGCGTCAGGAGCGTGCAGAGGCAAAGTGGGAGCGGGCGAGGCTGGAGCAGGAA
GCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCAAGCTGAATCAAAGAATTCGTCT
CATACGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCACATCTCAACATGTCACTGGTCGGGCCG
GTCTCAGAGAGCGGTCCTGAAGTCGTCGGCGAGCCCAGATCTGAAAAGCAGATTGAAACACTAGCCGTCGGTCAC
GCAGCCGCTGAGGGGGCGGCGCACGACAATCAGCTCATCAGCAAGTCCGGCGAATGCTCCGAAACCTCGAGCGAT
TCTACTTCGGTGAAACGCCAGAAGAGCGTGCGATTCTCTCCAAAGGTAGAGTCGACGACATTCCAACTGTCCGAT
CCTCCGAGCCCCAACCACGCGTCGGCCGCCAACAGCAGCAGCCCCATTGATAACGCGGAGGAGGAACTGGTCAAT
CAAGAGCACCTCCAGCTCATGCCCGAGGAGGCCTTCTTCCTGTGTTTCGGGCTGGGGGCCCTCCGCGTTACGGAG
CCCGACTCTGACGAGGCTCTGTCGACTCGGCAAATGTTGACACGCTTCCGGCAGTACTCGTATGTTCCGCCGCGG
ATCGGACCAGACGAGCCGGACCTGGAAGCGGACGACGCATTCCTGGTACATTACGCCGTCTATCACCACTTCCGC
TCGCTCGGCTGGGTGCCGCGAGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGTATGCCAGAGGGCCCGTGTTT
GATCACGCCGAGTTTGGCATCATCGTCATCCCATCGTACTCGGACCCGTGGTGGGAGAGGTCGGGCATTGGCAAG
TCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAC
GTGCCGCCGACGCCGAGGTTTGAGGAGGCTCTGGCGGTGGACGTTGGGGAGGCGATGAAGCTGTACAGGGTGAGG
GAGGTGATGGTGAAGCGGTGGTCGAGCAATCGAAATCGGTGAGCCTTTCGGGAGTCTCGCGAGGATGGTGGCCAT
GACGGCGCAAGGTGCAACGATGATCCGTGGTGAGGTCTCAGGTTTCGGTGAATGTCTCGGTGAGAGCTGTCACAG
CTGTCATCCGAGCTTCCCCGCATAGCCTCGGTCAACCCCGCGTCCCATAAACCCCGCGTCCGTCCCTTGACAGCA
TCCGTTCCACTCCTAGAACGGATACAGACCTGTCGTATGAGTAATTCGTCATGGCATCGCCCGCGCGGGTCGCCT
TTGGCCGGAGCTGCCTCTCGTGGCGTGGCCACAGAAAGATCAGCACGGCTGGCGGCAACAGCAGCATCCAGCGCA
TCGTCTCCCGCACAGCTTCGGGCCGGTTCCCAAGCCAGCCGCCGACCTCGTTCCCTCGACGGATCCCAAAGTATC
TGGAGCGGTTCCGGTACCGTCTTCCCTCGGTAAATGCCGACGGCGAAGAGGAGGCTGGCTGCGAGATGCCCATCA
GCGCCCGCAGCGATTATGAGGACAAAGAGCGGAGGAAGACTCAGCCCGATCCGACCCCGACTCCCATCGCCAGAC
CGGGATCGATATCCCAGCTCAAGAGGCCAAGCCAAAATCTCGACGACGAGGTTCAGGACATGCCAGACGTCTTCG
AGCTGACGCCGGCAGCGCGCGAACCAAAGCCCCTCGCGACGGCTTCCATCGACACTCGGCCGGTGGTGACGATAG
CTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTAAAAGAGCTTCGGCCGGCGGCGATCC
GCGACAACTGCGTTTGCCGGTTATGTCGAGACGCCGACTCGGGTAACAAGCTGTTCGAGTCGTCGCAAATTCCCA
CCGACATCGCTATCGAGAGCGCGCGAGCCACCGACGACGGGCTCTGGGTGAAGCTCATGAACGATACGCCCGGCC
ACGACGAGACGCTGGTGCCGTGGGAACAGGTCGAGGTGGCGCTGCGTCGACGGGGGGCTCGTGAGGGCTTCTTCC
CACGGCGGCCGTCGATATTGGGCCAGACGGGGATGCTATGCTGGGATCGGGACACGCTGCAGAGTGTTGTAAGGG
CCATCGACTACGAAGCCTTCATGTCAGGACATGACGATGATGCCGCCCTCTGGGACGTCATCATCGACCTCTGCC
GGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGATCTCGGGGCTGTCGAGGAGGTTACGACGCGGATTGCGA
ACCTGCGCGAGACGTTTTATGGGCGCGTCTTCGATGTCACGGCTGGAGCAGCGGATTCAGCCAGCAACGTGGCCT
ACACCTCGCGAGCGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCGCCGCCCCAGATCCAGGTGCTTCACT
GCCTCGACAACTCGTGCCCCGGCGGCGACTCCTTCTTCTCCGATTCGGAGCGCGTGGCGCGTCTGCTGTGGCCGT
TTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTCGACTACCATTACCGCGGCTACGACTACC
GCGAACCTCCCTTCCGTCACCACTTTTACCACGCCAGCCGGCCGGTTCTATCCCACGACGCCCTCACGGGTTTCA
CGCGCGTCTGGTGGAGTCCGCCCTTCCAGGCGCCGTCGCAACTGGCAGACCAGCAGCTGCAGCCGTGGATCCGAG
CAGCCCGGTTCTTCGAAGAGCTCGTCTCGGACCCAGAGGCCGTCTTCCGCGTGCGTCTCCAGCCGGGAGACTGCG
TCCTCTTCGACAACCGGCGCGTGCTGCACGGACGGGACGCGTTCGACGCCACGGCCAGCGGGTGTAAACGCTGGC
TTAGGGGCGCGTACATTGCTGCTGATGACTTTTGGAGCAGGGCTTCGCAGATGCCGGCTCAGCAGGCTGAGTATT
ATCGGGGGCCGGAGCTGTGGTCTAGCATGATGGAGAATCAGGATTTGAGGCATTCGCAGTGGAGGAAAAGGGTTG
AGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail