Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3567
Gene name
LocationContig_318:11956..13421
Strand-
Gene length (bp)1465
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 3.8E-09 80 129
PF04193 PQ-loop PQ loop repeat 1.2E-13 232 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 79 329 1.0E-34

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 76 95 19
2 108 130 22
3 155 177 22
4 200 222 22
5 227 249 22
6 262 284 22
7 294 313 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4827
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5267
Ophiocordyceps australis map64 (Brazil) OphauB2|4650
Ophiocordyceps camponoti-floridani Ophcf2|02865
Ophiocordyceps camponoti-rufipedis Ophun1|3567 (this protein)
Ophiocordyceps kimflemingae Ophio5|1428
Ophiocordyceps subramaniannii Hirsu2|10715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3567
MKPLQPRHSILGLSLATPNITLEPPSSTLSPTIRFYIFSTSAHPLASASPQSDRPAMAHMWELDDGACEHLRSPS
YLELVVSIVILIGLLISYFPQHYRIISRGTSEGISPYFVLLGTTSATAGFANVLTVPPSREAIGCCRELGAFDCA
AGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQDELGGESPKWQTAVAVGLLCVLHGLIVVILTGVFAVALP
SYLTTWANSLGVMAALLAAVQYVPQIWTTYRLKHVGSLSIPMMCMQTPGGFLFAASLFARLGVAGWSTWVIYLLT
ATMQGIVLVLGVYYEMDSRRHEGSLPPDLSVVPRSPLERSPSSQRPAANRTYSEGWERGLPGPFTGHPERYAETE
EDLDHMQEREARAIARENQPLLRPGGIGNPRRKYGSSRG*
Coding >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTTCCGCCCATCCTCTCGCATCGGCCTCGCCT
CAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGCGCATGCGAGCATCTCCGATCGCCATCA
TATCTCGAGCTCGTCGTCTCCATCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCGCAGCACTACCGCATC
ATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCTGCCACCGCCGGCTTC
GCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGTGCTTTTGACTGCGCT
GCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATTCTCGTCCTCTTCCTCATC
TTCTTCCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTC
GCCGTCGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCC
AGTTACCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAG
ATCTGGACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGC
TTCCTCTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACA
GCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTC
CCCCCCGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGC
ACGTACTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAG
GAGGATCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGT
GGCATTGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA
Transcript >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTTCCGCCCATCCTCTCGCATCGGCCTCGCCT
CAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGCGCATGCGAGCATCTCCGATCGCCATCA
TATCTCGAGCTCGTCGTCTCCATCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCGCAGCACTACCGCATC
ATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCTGCCACCGCCGGCTTC
GCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGTGCTTTTGACTGCGCT
GCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATTCTCGTCCTCTTCCTCATC
TTCTTCCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTC
GCCGTCGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCC
AGTTACCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAG
ATCTGGACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGC
TTCCTCTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACA
GCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTC
CCCCCCGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGC
ACGTACTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAG
GAGGATCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGT
GGCATTGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA
Gene >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTGTCCCAGCGTCATGATCACCTTTTGACTCT
CCAGCTGACTCGCCGACTCCTCAAGCTCTTCCCCACACCTCTCCGTCACCACGACTCACGCCCTGCGCTCAGTCC
GCCCATCCTCTCGCATCGGCCTCGCCTCAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGC
GCATGCGAGCATCTCCGATCGCCATCATATCTCGAGCTCGTCGTCTCCATGTGCGCACGCGCCCTCCCTTCCTCC
CCCCCTTTGTCTCACCCGCTAACGACGAACGACGACAGCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCG
CAGCACTACCGCATCATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCT
GCCACCGCCGGCTTCGCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGT
GCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATGTAA
GCCCGTCTCCGGCATGCGGCGGTGGTTGTGCGCCGCGCTGACGCGTCACAGTCTCGTCCTCTTCCTCATCTTCTT
CCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGT
CGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCCAGTTA
CCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATCTG
GACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGCTTCCT
CTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACAGCAAC
GATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTCCCCCC
CGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGCACGTA
CTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAGGAGGA
TCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGTGGCAT
TGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail