Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3567
Gene name
LocationContig_318:11956..13421
Strand-
Gene length (bp)1465
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 3.8E-09 80 129
PF04193 PQ-loop PQ loop repeat 1.2E-13 232 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 79 329 1.0E-34

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 76 95 19
2 108 130 22
3 155 177 22
4 200 222 22
5 227 249 22
6 262 284 22
7 294 313 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3567
MKPLQPRHSILGLSLATPNITLEPPSSTLSPTIRFYIFSTSAHPLASASPQSDRPAMAHMWELDDGACEHLRSPS
YLELVVSIVILIGLLISYFPQHYRIISRGTSEGISPYFVLLGTTSATAGFANVLTVPPSREAIGCCRELGAFDCA
AGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQDELGGESPKWQTAVAVGLLCVLHGLIVVILTGVFAVALP
SYLTTWANSLGVMAALLAAVQYVPQIWTTYRLKHVGSLSIPMMCMQTPGGFLFAASLFARLGVAGWSTWVIYLLT
ATMQGIVLVLGVYYEMDSRRHEGSLPPDLSVVPRSPLERSPSSQRPAANRTYSEGWERGLPGPFTGHPERYAETE
EDLDHMQEREARAIARENQPLLRPGGIGNPRRKYGSSRG*
Coding >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTTCCGCCCATCCTCTCGCATCGGCCTCGCCT
CAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGCGCATGCGAGCATCTCCGATCGCCATCA
TATCTCGAGCTCGTCGTCTCCATCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCGCAGCACTACCGCATC
ATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCTGCCACCGCCGGCTTC
GCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGTGCTTTTGACTGCGCT
GCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATTCTCGTCCTCTTCCTCATC
TTCTTCCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTC
GCCGTCGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCC
AGTTACCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAG
ATCTGGACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGC
TTCCTCTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACA
GCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTC
CCCCCCGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGC
ACGTACTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAG
GAGGATCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGT
GGCATTGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA
Transcript >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTTCCGCCCATCCTCTCGCATCGGCCTCGCCT
CAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGCGCATGCGAGCATCTCCGATCGCCATCA
TATCTCGAGCTCGTCGTCTCCATCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCGCAGCACTACCGCATC
ATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCTGCCACCGCCGGCTTC
GCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGTGCTTTTGACTGCGCT
GCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATTCTCGTCCTCTTCCTCATC
TTCTTCCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTC
GCCGTCGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCC
AGTTACCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAG
ATCTGGACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGC
TTCCTCTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACA
GCAACGATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTC
CCCCCCGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGC
ACGTACTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAG
GAGGATCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGT
GGCATTGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA
Gene >Ophun1|3567
ATGAAGCCCTTGCAGCCTCGTCACTCCATCCTCGGTCTCAGCCTCGCCACCCCAAACATCACCCTCGAACCGCCC
TCATCGACGCTCTCGCCCACTATCCGCTTCTACATCTTCAGCACTGTCCCAGCGTCATGATCACCTTTTGACTCT
CCAGCTGACTCGCCGACTCCTCAAGCTCTTCCCCACACCTCTCCGTCACCACGACTCACGCCCTGCGCTCAGTCC
GCCCATCCTCTCGCATCGGCCTCGCCTCAGAGCGACCGGCCAGCCATGGCCCACATGTGGGAGTTGGACGATGGC
GCATGCGAGCATCTCCGATCGCCATCATATCTCGAGCTCGTCGTCTCCATGTGCGCACGCGCCCTCCCTTCCTCC
CCCCCTTTGTCTCACCCGCTAACGACGAACGACGACAGCGTCATCCTCATCGGACTGCTGATTTCATACTTCCCG
CAGCACTACCGCATCATCTCTCGCGGAACTTCAGAAGGAATCTCGCCGTATTTCGTCCTTCTCGGCACCACGTCT
GCCACCGCCGGCTTCGCCAATGTTCTGACGGTTCCGCCCTCGAGGGAGGCTATTGGCTGTTGCAGAGAGCTGGGT
GCTTTTGACTGCGCTGCGGGCTTGCTTGGCGTTGCTCAGCTTGGGGTGCAGTGGCTTTGCTTCACTCTCATGTAA
GCCCGTCTCCGGCATGCGGCGGTGGTTGTGCGCCGCGCTGACGCGTCACAGTCTCGTCCTCTTCCTCATCTTCTT
CCGCTATCGGGAGGCCAATGTCCCCCAAGACGAGCTAGGCGGGGAGTCGCCCAAGTGGCAAACGGCCGTCGCCGT
CGGCCTGCTGTGCGTTCTTCACGGCCTCATCGTCGTCATTCTCACCGGCGTCTTCGCCGTGGCGTTACCCAGTTA
CCTCACTACCTGGGCCAACTCTCTCGGCGTCATGGCCGCCCTCCTGGCCGCGGTCCAGTACGTGCCGCAGATCTG
GACGACGTACCGCCTCAAGCACGTCGGGAGTCTCAGCATCCCCATGATGTGCATGCAGACGCCGGGAGGCTTCCT
CTTCGCCGCCAGTCTCTTTGCCCGGCTGGGCGTCGCCGGCTGGAGCACATGGGTCATCTACCTCTTGACAGCAAC
GATGCAGGGCATCGTCCTCGTCCTCGGCGTCTACTACGAAATGGACTCGCGTCGACACGAAGGCAGCCTCCCCCC
CGACCTGAGCGTGGTGCCGCGCTCGCCGCTGGAACGGTCCCCCTCATCGCAACGACCGGCAGCGAACCGCACGTA
CTCGGAAGGGTGGGAACGCGGCTTGCCGGGGCCTTTTACCGGGCATCCAGAACGCTACGCCGAGACGGAGGAGGA
TCTCGACCACATGCAGGAGCGGGAAGCGCGAGCTATTGCCCGAGAGAACCAGCCGTTGCTTCGACCGGGTGGCAT
TGGCAACCCGCGGCGCAAGTACGGTTCTAGCCGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail