Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3562
Gene name
LocationContig_318:3020..4538
Strand-
Gene length (bp)1518
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04646 DUF604 Protein of unknown function, DUF604 2.1E-07 283 367
PF02434 Fringe Fringe-like 9.5E-07 231 328

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3562
MRRRKTVTLVYLSAIVAFALVCSLMRHGSSFSSDAAFLRTGHSAHAKTCALDASHLADIKQRYHVDHRFHYFTRT
IRFRPTKGLDRKPMTLLPQTLLTAAKPSIVDVSDPEAAFYGDCPPPLQVKVPLSALPSTVNASDFMFGISTTYQR
LNESRDEIVDDWKYWLTDGDGQSNGAKLHLTLLEASNDQLHEVSAFLRQAGIDAAVHRSQDRDMPVRYINLVPHL
YRNQDSLSRKWLVLCDDDTFFPSMHSLVRRFSSFDHTRELYIGTLSEDVGAVERHGSQAFGGAGVFLSLPMAKRI
TQSIDECASSEKVNEAGWQGDKLLRNCIYDHSDTRLVVLPDLWQLDFRGDAAGFYEWGPKPLSLHHYRGGGWHTA
RPAQFSKIAYVCGEDCILQRFQTADNFILSGHSVAYYPGGITFDTSQVERTFEALQDKSWNFDFVFGPQRPPLRG
EGQKIAWEIRGSDVRADGSVVQTFVRKKDHVRWEGAAGQQMGELDSVVELVWRPF*
Coding >Ophun1|3562
ATGCGCCGCCGCAAGACAGTGACGCTCGTCTACCTTTCTGCCATCGTCGCCTTCGCTCTCGTCTGCAGCTTGATG
CGCCATGGTTCCTCTTTCAGTTCAGATGCCGCCTTCTTGCGAACTGGGCATTCTGCCCATGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACCATGTCGACCATCGCTTCCACTACTTCACTCGAACC
ATCCGCTTTCGACCTACAAAGGGCCTCGACCGAAAGCCCATGACGCTGCTACCTCAGACGCTCCTAACCGCCGCC
AAACCCTCGATAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGCGACTGCCCCCCCCCCCTGCAGGTCAAA
GTGCCCCTTTCCGCCCTGCCTTCGACGGTCAACGCCTCCGACTTCATGTTCGGCATCTCCACCACGTACCAGCGC
CTCAACGAGTCTCGCGACGAAATCGTCGACGACTGGAAATATTGGCTCACCGATGGCGACGGCCAATCCAACGGC
GCCAAGCTCCATCTCACCCTCCTCGAAGCCAGCAACGATCAGCTTCACGAAGTCAGCGCATTCCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCTCAAGACCGAGACATGCCGGTCCGCTACATCAACCTTGTCCCGCATCTA
TACCGAAACCAAGACTCGCTCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTCTTCCCTAGCATGCAT
AGCCTCGTCCGTCGCTTCTCCTCCTTCGATCACACCCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTCGGT
GCCGTCGAGCGTCACGGCTCTCAGGCCTTTGGCGGCGCAGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATC
ACACAGTCCATCGATGAGTGCGCCTCGTCGGAAAAGGTCAACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGACACCCGCCTCGTCGTCCTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
GCAGCCGGCTTCTACGAATGGGGGCCCAAGCCGCTATCACTACACCACTACCGCGGCGGCGGCTGGCACACGGCT
CGTCCCGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGCCATTCCGTCGCCTACTACCCGGGCGGCATCACCTTCGACACCAGCCAGGTGGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTTGACTTTGTCTTTGGGCCGCAGCGGCCGCCGCTCAGGGGG
GAAGGACAGAAGATTGCCTGGGAGATTCGCGGCTCTGACGTTCGGGCTGATGGATCGGTGGTGCAGACGTTTGTC
AGGAAGAAGGATCATGTTCGCTGGGAGGGGGCCGCTGGTCAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGGCCTTTTTAG
Transcript >Ophun1|3562
ATGCGCCGCCGCAAGACAGTGACGCTCGTCTACCTTTCTGCCATCGTCGCCTTCGCTCTCGTCTGCAGCTTGATG
CGCCATGGTTCCTCTTTCAGTTCAGATGCCGCCTTCTTGCGAACTGGGCATTCTGCCCATGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACCATGTCGACCATCGCTTCCACTACTTCACTCGAACC
ATCCGCTTTCGACCTACAAAGGGCCTCGACCGAAAGCCCATGACGCTGCTACCTCAGACGCTCCTAACCGCCGCC
AAACCCTCGATAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGCGACTGCCCCCCCCCCCTGCAGGTCAAA
GTGCCCCTTTCCGCCCTGCCTTCGACGGTCAACGCCTCCGACTTCATGTTCGGCATCTCCACCACGTACCAGCGC
CTCAACGAGTCTCGCGACGAAATCGTCGACGACTGGAAATATTGGCTCACCGATGGCGACGGCCAATCCAACGGC
GCCAAGCTCCATCTCACCCTCCTCGAAGCCAGCAACGATCAGCTTCACGAAGTCAGCGCATTCCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCTCAAGACCGAGACATGCCGGTCCGCTACATCAACCTTGTCCCGCATCTA
TACCGAAACCAAGACTCGCTCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTCTTCCCTAGCATGCAT
AGCCTCGTCCGTCGCTTCTCCTCCTTCGATCACACCCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTCGGT
GCCGTCGAGCGTCACGGCTCTCAGGCCTTTGGCGGCGCAGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATC
ACACAGTCCATCGATGAGTGCGCCTCGTCGGAAAAGGTCAACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGACACCCGCCTCGTCGTCCTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
GCAGCCGGCTTCTACGAATGGGGGCCCAAGCCGCTATCACTACACCACTACCGCGGCGGCGGCTGGCACACGGCT
CGTCCCGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGCCATTCCGTCGCCTACTACCCGGGCGGCATCACCTTCGACACCAGCCAGGTGGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTTGACTTTGTCTTTGGGCCGCAGCGGCCGCCGCTCAGGGGG
GAAGGACAGAAGATTGCCTGGGAGATTCGCGGCTCTGACGTTCGGGCTGATGGATCGGTGGTGCAGACGTTTGTC
AGGAAGAAGGATCATGTTCGCTGGGAGGGGGCCGCTGGTCAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGGCCTTTTTAG
Gene >Ophun1|3562
ATGCGCCGCCGCAAGACAGTGACGCTCGTCTACCTTTCTGCCATCGTCGCCTTCGCTCTCGTCTGCAGCTTGATG
CGCCATGGTTCCTCTTTCAGTTCAGATGCCGCCTTCTTGCGAACTGGGCATTCTGCCCATGCCAAGACGTGCGCT
TTAGATGCTTCGCACTTGGCGGATATCAAGCAACGATACCATGTCGACCATCGCTTCCACTACTTCACTCGAACC
ATCCGCTTTCGACCTACAAAGGGCCTCGACCGAAAGCCCATGACGCTGCTACCTCAGACGCTCCTAACCGCCGCC
AAACCCTCGATAGTCGACGTCTCCGACCCTGAAGCCGCCTTCTACGGCGACTGCCCCCCCCCCCTGCAGGTCAAA
GTGCCCCTTTCCGCCCTGCCTTCGACGGTCAACGCCTCCGACTTCATGTTCGGCATCTCCACCACGTACCAGCGC
CTCAACGAGTCTCGCGACGAAATCGTCGACGACTGGAAATATTGGCTCACCGATGGCGACGGCCAATCCAACGGC
GCCAAGCTCCATCTCACCCTCCTCGAAGCCAGCAACGATCAGCTTCACGAAGTCAGCGCATTCCTCCGACAGGCC
GGCATCGACGCCGCCGTCCACCGTTCTCAAGACCGAGACATGCCGGTCCGCTACATCAACCTTGTCCCGCATCTA
TACCGAAACCAAGACTCGCTCTCGCGCAAGTGGCTGGTCCTCTGCGACGACGATACCTTCTTCCCTAGCATGCAT
AGCCTCGTCCGTCGCTTCTCCTCCTTCGATCACACCCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTCGGT
GCCGTCGAGCGTCACGGCTCTCAGGCCTTTGGCGGCGCAGGCGTCTTCCTCTCGCTGCCCATGGCCAAGCGCATC
ACACAGTCCATCGATGAGTGCGCCTCGTCGGAAAAGGTCAACGAGGCCGGCTGGCAGGGAGACAAGCTGCTGCGC
AACTGCATCTACGACCACAGCGACACCCGCCTCGTCGTCCTGCCTGACCTCTGGCAGCTCGACTTCCGCGGCGAC
GCAGCCGGCTTCTACGAATGGGGGCCCAAGCCGCTATCACTACACCACTACCGCGGCGGCGGCTGGCACACGGCT
CGTCCCGCCCAGTTCAGCAAAATCGCCTACGTCTGCGGCGAGGACTGCATCCTCCAGCGCTTCCAGACGGCCGAC
AACTTCATCCTCTCCGGCCATTCCGTCGCCTACTACCCGGGCGGCATCACCTTCGACACCAGCCAGGTGGAGCGC
ACCTTTGAGGCGCTGCAGGACAAGAGCTGGAACTTTGACTTTGTCTTTGGGCCGCAGCGGCCGCCGCTCAGGGGG
GAAGGACAGAAGATTGCCTGGGAGATTCGCGGCTCTGACGTTCGGGCTGATGGATCGGTGGTGCAGACGTTTGTC
AGGAAGAAGGATCATGTTCGCTGGGAGGGGGCCGCTGGTCAGCAGATGGGCGAGCTGGATAGCGTTGTTGAGCTG
GTTTGGAGGCCTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail