Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3560
Gene name
LocationContig_317:16819..20730
Strand+
Gene length (bp)3911
Transcript length (bp)2922
Coding sequence length (bp)2922
Protein length (aa) 974

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 1.1E-10 639 686
PF13191 AAA_16 AAA ATPase domain 3.7E-09 738 895
PF13401 AAA_22 AAA domain 5.6E-08 759 901
PF00004 AAA ATPase family associated with various cellular activities (AAA) 9.6E-08 762 919
PF13831 PHD_2 PHD-finger 4.5E-08 652 685

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y794|ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc4 PE=1 SV=1 696 942 1.0E-57
sp|Q2YDI2|ORC4_BOVIN Origin recognition complex subunit 4 OS=Bos taurus GN=ORC4 PE=2 SV=1 711 940 1.0E-40
sp|O43929|ORC4_HUMAN Origin recognition complex subunit 4 OS=Homo sapiens GN=ORC4 PE=1 SV=2 717 940 4.0E-40
sp|Q6P9Z8|ORC4_RAT Origin recognition complex subunit 4 OS=Rattus norvegicus GN=Orc4 PE=2 SV=1 717 940 4.0E-40
sp|Q5R6Z7|ORC4_PONAB Origin recognition complex subunit 4 OS=Pongo abelii GN=ORC4 PE=2 SV=1 717 940 9.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y794|ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc4 PE=1 SV=1 696 942 1.0E-57
sp|Q2YDI2|ORC4_BOVIN Origin recognition complex subunit 4 OS=Bos taurus GN=ORC4 PE=2 SV=1 711 940 1.0E-40
sp|O43929|ORC4_HUMAN Origin recognition complex subunit 4 OS=Homo sapiens GN=ORC4 PE=1 SV=2 717 940 4.0E-40
sp|Q6P9Z8|ORC4_RAT Origin recognition complex subunit 4 OS=Rattus norvegicus GN=Orc4 PE=2 SV=1 717 940 4.0E-40
sp|Q5R6Z7|ORC4_PONAB Origin recognition complex subunit 4 OS=Pongo abelii GN=ORC4 PE=2 SV=1 717 940 9.0E-40
sp|O88708|ORC4_MOUSE Origin recognition complex subunit 4 OS=Mus musculus GN=Orc4 PE=1 SV=2 717 940 1.0E-39
sp|Q4U3P8|ORC4_CRIGR Origin recognition complex subunit 4 OS=Cricetulus griseus GN=ORC4 PE=2 SV=1 717 940 2.0E-38
sp|O93479|ORC4_XENLA Origin recognition complex subunit 4 OS=Xenopus laevis GN=orc4 PE=2 SV=1 738 940 2.0E-38
sp|P54791|ORC4_YEAST Origin recognition complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORC4 PE=1 SV=1 719 942 4.0E-35
sp|Q6EWX1|ORC4_ARATH Origin of replication complex subunit 4 OS=Arabidopsis thaliana GN=ORC4 PE=1 SV=1 743 926 4.0E-29
sp|Q5N8Q4|ORC4_ORYSJ Origin of replication complex subunit 4 OS=Oryza sativa subsp. japonica GN=ORC4 PE=2 SV=1 743 925 8.0E-25
sp|Q86AD6|ORC4_DICDI Origin recognition complex subunit 4 OS=Dictyostelium discoideum GN=orcD PE=3 SV=1 737 941 7.0E-16
sp|Q29EQ3|RNO_DROPS PHD finger protein rhinoceros OS=Drosophila pseudoobscura pseudoobscura GN=rno PE=3 SV=2 635 684 1.0E-09
sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 635 684 1.0E-09
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 629 684 1.0E-09
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 624 689 4.0E-09
sp|Q6IE82|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Jade3 PE=1 SV=1 635 684 7.0E-09
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 635 686 7.0E-09
sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=jade1 PE=2 SV=1 635 684 9.0E-09
sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=JADE3 PE=1 SV=1 635 684 1.0E-08
sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Jade1 PE=1 SV=2 635 684 1.0E-08
sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=JADE1 PE=1 SV=1 635 684 2.0E-08
sp|Q0P4S5|JADE3_XENTR Protein Jade-3 OS=Xenopus tropicalis GN=jade3 PE=2 SV=1 635 684 2.0E-08
sp|Q7ZVP1|JADE3_DANRE Protein Jade-3 OS=Danio rerio GN=jade3 PE=2 SV=1 635 684 2.0E-08
sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=jade1 PE=2 SV=1 635 684 3.0E-08
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 587 686 3.0E-08
sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=JADE1 PE=2 SV=1 635 684 6.0E-08
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 640 684 7.0E-08
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 624 684 6.0E-07
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Jade2 PE=1 SV=2 635 684 6.0E-07
sp|Q9NQC1|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=JADE2 PE=1 SV=2 635 684 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3560
MIRQHRVAAPTISLLLRPESEAGLARGIASSNRSARRAMPPDAVNSSEFSYFLGFIPTLPVNDMTVSTPMVLQDD
EDDDEEDEEEALSIIDNALKSVWFPEGYWAERRLSSQPPRKSTASSRFWKWRSRSNKSTTSDLDAGESLPWSSLP
TSASAPAGMSSAEVAAFAAGFAASPPPLPSPYFSEKAHVFSLQHPGQGTGKGGPFMGTLADEPTEGEDAGSQRTA
VKRDSAAANSQATSKNTGSTLRSSISWFSSTRRWLSRAVEAASAGSFDAAFRPPTSAKTNCNVKYSQFPGGEAVR
VSTPPLDEDTADGKPRGFFTCTTPPSASGRPASPMPPPRSVASSLRHSSVSASTREWWEPPRQRSTRPPVTAAAR
FQFDLPEHLPSSPLCPANRRRVSTRWPGTGLDLNLRDDERNGHQLCAQAAEVTVYYSADASMDPPSGRKRQVTEA
ASTPASSKRRRLDDANAQSPTTPQALKTTASMAPSASPQPIETNGQSAARPAIKLAALKGTKWDRGDIGDARMSR
QPSTPTRVSARSSPSSRRAASTSKRAAGRPSGRAVAEAVVDDGDELGRSPAKLRGILTPSKNRVRRLKSVTFNRG
DEVYFEDLPKSASATKTRASKAKQAKAEVEEEADDDEIRCGICSKADSRPPNQIILCDNCDFATHLACYDLPDIP
EGDWLCKSCRQEDAVQMTSKPATVPDSDAAEVPDIANLDQHLRSLQRVLLDRCCGRRRIRMCGLEECYDQARQLV
EQTVVAAEGNSMLLIGPRGCGKTTMVENMIVDLSREHRHLFHVVRLSGFIHTDDKVALKEIWRQLGKEMEVEDEL
VNRTNYADTLASLLALLSHPSEISGADTGVTSQSVIFIIDEFDMFACHGRQTLLYNLLDIAQSRKAPIAVLGCTT
RLDVVEMLEKRVKSRFSHRCVYVSPPRSLAAFWQVCRQGLMVDWHDVGAEGIDAGLDGYDDFHRYWTMKIEVR*
Coding >Ophun1|3560
ATGATCCGTCAGCATCGAGTCGCCGCTCCCACCATCTCGCTCCTGCTGCGGCCCGAAAGCGAGGCCGGGCTGGCG
CGAGGCATCGCCTCATCGAACAGGTCGGCTCGGAGAGCCATGCCGCCCGACGCCGTAAACTCCAGCGAGTTTAGC
TACTTTCTCGGCTTCATACCGACTCTGCCGGTGAATGACATGACAGTCTCGACGCCAATGGTTCTGCAAGACGAC
GAGGACGACGATGAGGAGGATGAAGAGGAGGCGCTCAGTATAATTGACAACGCCTTGAAAAGTGTGTGGTTCCCG
GAGGGCTACTGGGCCGAGCGGCGGTTATCGAGCCAGCCGCCGCGGAAGAGCACCGCCAGCTCGCGCTTCTGGAAG
TGGCGATCGCGCTCCAACAAGTCGACGACGAGCGATCTCGATGCCGGAGAGTCGCTGCCATGGTCTTCGCTGCCG
ACGTCTGCGAGCGCGCCGGCGGGCATGTCGAGTGCCGAGGTGGCGGCCTTTGCAGCCGGTTTCGCCGCCTCGCCG
CCTCCGTTGCCGAGCCCCTATTTCTCGGAGAAGGCTCATGTGTTTTCCCTGCAGCATCCGGGTCAGGGAACTGGA
AAGGGGGGGCCGTTCATGGGCACGCTTGCAGACGAGCCTACGGAGGGCGAGGACGCCGGGTCGCAGCGGACGGCC
GTCAAGCGAGACTCGGCCGCAGCGAACTCGCAGGCGACGTCCAAGAATACAGGCAGCACCCTTCGCTCGTCCATC
TCGTGGTTTAGCTCTACCCGTCGCTGGCTCAGTCGTGCCGTCGAGGCAGCATCGGCCGGTTCTTTCGACGCCGCC
TTCCGGCCCCCAACCTCGGCCAAGACGAATTGCAACGTCAAGTACAGCCAGTTCCCCGGCGGCGAGGCCGTTCGA
GTCAGCACCCCGCCACTGGACGAGGACACTGCCGACGGAAAGCCACGGGGCTTCTTCACCTGTACGACGCCGCCG
TCTGCCTCCGGGCGGCCCGCGTCGCCGATGCCTCCGCCACGGTCAGTGGCCAGCAGTCTCCGCCACTCCAGCGTG
TCCGCCTCGACGCGCGAGTGGTGGGAGCCTCCTCGCCAGCGGTCAACTCGTCCTCCCGTCACGGCCGCCGCAAGA
TTCCAGTTCGACCTGCCGGAGCATCTCCCTTCCAGCCCGCTGTGTCCTGCCAATCGTCGACGCGTCTCGACGCGT
TGGCCCGGGACCGGCCTTGACCTAAATTTGCGGGACGACGAACGAAATGGCCACCAGCTCTGCGCTCAAGCTGCT
GAGGTAACCGTCTACTACTCCGCTGATGCCTCCATGGATCCTCCATCCGGTCGCAAGAGACAGGTCACCGAGGCA
GCCTCGACGCCAGCGTCTAGCAAGCGTCGCAGGCTGGACGATGCCAACGCCCAATCGCCGACGACGCCCCAGGCC
CTAAAGACGACGGCATCGATGGCCCCGAGCGCCTCTCCACAACCTATCGAAACCAATGGCCAGTCTGCCGCGCGG
CCGGCCATCAAGCTGGCTGCTCTCAAGGGCACCAAGTGGGATAGGGGTGATATCGGCGATGCTAGGATGTCGCGA
CAGCCCTCTACGCCCACGCGGGTCTCGGCTCGGTCGTCGCCTTCTTCGAGGAGAGCGGCTTCGACTTCGAAACGT
GCTGCGGGGAGGCCTTCGGGGAGGGCGGTGGCGGAGGCTGTGGTTGATGATGGCGATGAGCTTGGCAGGTCGCCT
GCCAAGTTGCGCGGGATCCTTACCCCGTCGAAGAATCGAGTTCGTCGGCTCAAGAGCGTTACGTTTAATCGGGGC
GATGAGGTTTACTTTGAAGACCTGCCCAAGTCTGCTTCGGCTACCAAGACGCGCGCTTCCAAGGCGAAGCAGGCG
AAGGCGGAGGTGGAGGAGGAGGCAGACGATGATGAGATTCGCTGCGGCATCTGCTCCAAGGCCGACTCCCGACCG
CCCAACCAGATCATCCTCTGCGATAACTGCGACTTCGCCACCCACCTGGCATGTTACGATTTGCCGGATATTCCA
GAGGGAGACTGGCTGTGCAAGTCTTGCAGACAGGAAGACGCGGTGCAGATGACCAGCAAGCCCGCAACCGTACCC
GACTCGGACGCGGCCGAGGTTCCCGACATTGCCAACCTGGATCAACACCTGCGGTCCCTCCAGCGGGTGCTGCTC
GACAGGTGCTGCGGCCGGCGACGCATACGCATGTGCGGGCTGGAAGAGTGCTACGACCAGGCGCGGCAGTTGGTT
GAGCAGACGGTTGTTGCGGCCGAGGGCAACTCGATGCTGCTCATCGGGCCCAGGGGCTGTGGGAAGACGACGATG
GTGGAGAATATGATTGTCGACTTGTCGCGAGAGCATCGACATTTATTTCATGTCGTTCGTCTCAGTGGCTTCATC
CATACGGACGACAAGGTGGCGCTCAAGGAGATTTGGCGTCAGCTTGGCAAGGAGATGGAGGTTGAGGATGAGCTG
GTCAATCGGACAAACTACGCCGACACACTGGCCTCACTACTGGCCCTCCTCTCGCACCCGTCCGAAATCTCAGGC
GCAGACACAGGCGTGACATCTCAATCCGTCATCTTCATCATCGACGAATTCGACATGTTCGCCTGCCACGGCCGC
CAAACGCTACTCTACAACCTCCTCGACATCGCGCAATCCCGCAAAGCCCCCATCGCCGTCCTCGGCTGCACGACG
CGTCTGGACGTGGTGGAGATGCTGGAGAAGAGAGTCAAGAGCCGGTTCAGCCACCGGTGCGTCTACGTCTCGCCT
CCCAGGTCGCTGGCTGCGTTCTGGCAGGTCTGTCGGCAGGGGCTGATGGTTGACTGGCATGACGTGGGGGCCGAG
GGCATCGATGCGGGTTTGGATGGGTATGATGACTTTCATCGTTACTGGACGATGAAGATTGAGGTGCGTTGA
Transcript >Ophun1|3560
ATGATCCGTCAGCATCGAGTCGCCGCTCCCACCATCTCGCTCCTGCTGCGGCCCGAAAGCGAGGCCGGGCTGGCG
CGAGGCATCGCCTCATCGAACAGGTCGGCTCGGAGAGCCATGCCGCCCGACGCCGTAAACTCCAGCGAGTTTAGC
TACTTTCTCGGCTTCATACCGACTCTGCCGGTGAATGACATGACAGTCTCGACGCCAATGGTTCTGCAAGACGAC
GAGGACGACGATGAGGAGGATGAAGAGGAGGCGCTCAGTATAATTGACAACGCCTTGAAAAGTGTGTGGTTCCCG
GAGGGCTACTGGGCCGAGCGGCGGTTATCGAGCCAGCCGCCGCGGAAGAGCACCGCCAGCTCGCGCTTCTGGAAG
TGGCGATCGCGCTCCAACAAGTCGACGACGAGCGATCTCGATGCCGGAGAGTCGCTGCCATGGTCTTCGCTGCCG
ACGTCTGCGAGCGCGCCGGCGGGCATGTCGAGTGCCGAGGTGGCGGCCTTTGCAGCCGGTTTCGCCGCCTCGCCG
CCTCCGTTGCCGAGCCCCTATTTCTCGGAGAAGGCTCATGTGTTTTCCCTGCAGCATCCGGGTCAGGGAACTGGA
AAGGGGGGGCCGTTCATGGGCACGCTTGCAGACGAGCCTACGGAGGGCGAGGACGCCGGGTCGCAGCGGACGGCC
GTCAAGCGAGACTCGGCCGCAGCGAACTCGCAGGCGACGTCCAAGAATACAGGCAGCACCCTTCGCTCGTCCATC
TCGTGGTTTAGCTCTACCCGTCGCTGGCTCAGTCGTGCCGTCGAGGCAGCATCGGCCGGTTCTTTCGACGCCGCC
TTCCGGCCCCCAACCTCGGCCAAGACGAATTGCAACGTCAAGTACAGCCAGTTCCCCGGCGGCGAGGCCGTTCGA
GTCAGCACCCCGCCACTGGACGAGGACACTGCCGACGGAAAGCCACGGGGCTTCTTCACCTGTACGACGCCGCCG
TCTGCCTCCGGGCGGCCCGCGTCGCCGATGCCTCCGCCACGGTCAGTGGCCAGCAGTCTCCGCCACTCCAGCGTG
TCCGCCTCGACGCGCGAGTGGTGGGAGCCTCCTCGCCAGCGGTCAACTCGTCCTCCCGTCACGGCCGCCGCAAGA
TTCCAGTTCGACCTGCCGGAGCATCTCCCTTCCAGCCCGCTGTGTCCTGCCAATCGTCGACGCGTCTCGACGCGT
TGGCCCGGGACCGGCCTTGACCTAAATTTGCGGGACGACGAACGAAATGGCCACCAGCTCTGCGCTCAAGCTGCT
GAGGTAACCGTCTACTACTCCGCTGATGCCTCCATGGATCCTCCATCCGGTCGCAAGAGACAGGTCACCGAGGCA
GCCTCGACGCCAGCGTCTAGCAAGCGTCGCAGGCTGGACGATGCCAACGCCCAATCGCCGACGACGCCCCAGGCC
CTAAAGACGACGGCATCGATGGCCCCGAGCGCCTCTCCACAACCTATCGAAACCAATGGCCAGTCTGCCGCGCGG
CCGGCCATCAAGCTGGCTGCTCTCAAGGGCACCAAGTGGGATAGGGGTGATATCGGCGATGCTAGGATGTCGCGA
CAGCCCTCTACGCCCACGCGGGTCTCGGCTCGGTCGTCGCCTTCTTCGAGGAGAGCGGCTTCGACTTCGAAACGT
GCTGCGGGGAGGCCTTCGGGGAGGGCGGTGGCGGAGGCTGTGGTTGATGATGGCGATGAGCTTGGCAGGTCGCCT
GCCAAGTTGCGCGGGATCCTTACCCCGTCGAAGAATCGAGTTCGTCGGCTCAAGAGCGTTACGTTTAATCGGGGC
GATGAGGTTTACTTTGAAGACCTGCCCAAGTCTGCTTCGGCTACCAAGACGCGCGCTTCCAAGGCGAAGCAGGCG
AAGGCGGAGGTGGAGGAGGAGGCAGACGATGATGAGATTCGCTGCGGCATCTGCTCCAAGGCCGACTCCCGACCG
CCCAACCAGATCATCCTCTGCGATAACTGCGACTTCGCCACCCACCTGGCATGTTACGATTTGCCGGATATTCCA
GAGGGAGACTGGCTGTGCAAGTCTTGCAGACAGGAAGACGCGGTGCAGATGACCAGCAAGCCCGCAACCGTACCC
GACTCGGACGCGGCCGAGGTTCCCGACATTGCCAACCTGGATCAACACCTGCGGTCCCTCCAGCGGGTGCTGCTC
GACAGGTGCTGCGGCCGGCGACGCATACGCATGTGCGGGCTGGAAGAGTGCTACGACCAGGCGCGGCAGTTGGTT
GAGCAGACGGTTGTTGCGGCCGAGGGCAACTCGATGCTGCTCATCGGGCCCAGGGGCTGTGGGAAGACGACGATG
GTGGAGAATATGATTGTCGACTTGTCGCGAGAGCATCGACATTTATTTCATGTCGTTCGTCTCAGTGGCTTCATC
CATACGGACGACAAGGTGGCGCTCAAGGAGATTTGGCGTCAGCTTGGCAAGGAGATGGAGGTTGAGGATGAGCTG
GTCAATCGGACAAACTACGCCGACACACTGGCCTCACTACTGGCCCTCCTCTCGCACCCGTCCGAAATCTCAGGC
GCAGACACAGGCGTGACATCTCAATCCGTCATCTTCATCATCGACGAATTCGACATGTTCGCCTGCCACGGCCGC
CAAACGCTACTCTACAACCTCCTCGACATCGCGCAATCCCGCAAAGCCCCCATCGCCGTCCTCGGCTGCACGACG
CGTCTGGACGTGGTGGAGATGCTGGAGAAGAGAGTCAAGAGCCGGTTCAGCCACCGGTGCGTCTACGTCTCGCCT
CCCAGGTCGCTGGCTGCGTTCTGGCAGGTCTGTCGGCAGGGGCTGATGGTTGACTGGCATGACGTGGGGGCCGAG
GGCATCGATGCGGGTTTGGATGGGTATGATGACTTTCATCGTTACTGGACGATGAAGATTGAGGTGCGTTGA
Gene >Ophun1|3560
ATGATCCGTCAGCATCGAGTCGCCGCTCCCACCATCTCGCTCCTGCTGCGGCCCGAAAGCGAGGCCGGGCTGGCG
CGAGGCATCGCCTCATCGAACAGGTCGGCTCGGAGAGCCATGCCGCCCGACGCCGTAAACTCCAGCGAGTTTAGG
TGCGTGTTCGTACAGTCCACTCGGCCCGCGGGCGACGGCTTACGCGCCTTTGCCTCAGCTACTTTCTCGGCTTCA
TACCGACTCTGCCGGTGAATGACATGACAGTCTCGACGCCAATGGTTCTGCAAGACGACGAGGACGACGATGAGG
AGGATGAAGAGGAGGCGCTCAGTATAATTGACAACGCCTTGAAAAGTGTCTGCGAGAACAAAGTCCCAAGCCTCG
TATGGCGTCGAGCGATGCCTGACGACGGGGCTCTAACGGACACATCGTCGCCCTCGTCCGGCATCAAGGCAGCAA
CACACTCGCGCGGCCACAGCTTCGACCCTCCCCGCCCGGCCCGCGACGAATTCGAATAGGTGTGGTTCCCGGAGG
GCTACTGGGCCGAGCGGCGGTTATCGAGCCAGCCGCCGCGGAAGAGCACCGCCAGCTCGCGCTTCTGGAAGTGGC
GATCGCGCTCCAACAAGTCGACGACGAGCGATCTCGATGCCGGAGAGTCGCTGCCATGGTCTTCGCTGCCGACGT
CTGCGAGCGCGCCGGCGGGCATGTCGAGTGCCGAGGTGGCGGCCTTTGCAGCCGGTTTCGCCGCCTCGCCGCCTC
CGTTGCCGAGCCCCTATTTCTCGGAGAAGGCTCATGTGTTTTCCCTGCAGCATCCGGGTCAGGGAACTGGAAAGG
GGGGGCCGTTCATGGGCACGCTTGCAGACGAGCCTACGGAGGGCGAGGACGCCGGGTCGCAGCGGACGGCCGTCA
AGCGAGACTCGGCCGCAGCGAACTCGCAGGCGACGTCCAAGAATACAGGCAGCACCCTTCGCTCGTCCATCTCGT
GGTTTAGCTCTACCCGTCGCTGGCTCAGTCGTGCCGTCGAGGCGTTGAGTCGCAGAGAGGTAAACAAGTGTCGAG
ACTTGGCCATCGTCTCGTGATGCTAATCTTCACTCCGGCTGAGCAGAGACGCAATACACATCATACGTCATCGAG
AAGGAGGTCCTCTCGCTGGCTCTTTGGTCGGCGTCGCAGAGCATCGGCCGGTTCTTTCGACGCCGCCTTCCGGCC
CCCAACCTCGGCCAAGACGAATTGTGAGACGCTCTGCCATCTCTGATCTCGTCAGGCAGTCCTAAACTGACTCCT
CTCGGGTACAGGCAACGTCAAGTACAGCCAGTTCCCCGGCGGCGTACGTCCCCTTATACTTCCGACGTAGACGCG
CAGGCTCACGTCAGGACAGGAGGCCGTTCGAGTCAGCACCCCGCCACTGGACGAGGACACTGCCGACGGAAAGCC
ACGGGGCTTCTTCACCTGTACGACGCCGCCGTCTGCCTCCGGGCGGCCCGCGTCGCCGATGCCTCCGCCACGGTC
AGTGGCCAGCAGTCTCCGCCACTCCAGCGTGTCCGCCTCGACGCGCGAGTGGTGGGAGCCTCCTCGCCAGCGGTC
AACTCGTCCTCCCGTCACGGCCGCCGCAAGATTCCAGTTCGACCTGCCGGAGCATCTCCCTTCCAGCCCGCTGTG
TCCTGCCAATCGTCGGTACCGGCCCGGCGGCGTCTGTGTCTACCATGGGAGGGCGAAGGGATCTGCTCTTGGGAT
GGGGGACGGCTCGGGTTCCGAGGGGGGGGAATGAGGTGGTGATATTGACCTCTGCAGGATCAGGGTCGCATTTGA
AGTCTAACGAGGAGGACAGGGAGATTGGTGGTTCGACGCCGTTGCTTTTCTTCCCTACATGTACGATTTCTTCGA
TGGCCGGCTGCCGAGATCGTTGTCAAACAGTGCTGTATCTTTCATGGCTATCGCTTGCTGAGCCAGTGGCTATTA
TTGGTGTTGTTCATTGGAGCCCAGTCTCCATGATGAACAAGGAGTTCATCAAATCAGTCACGTGATGAACAATCT
GTAAGCGCTATGCGCGTTAATTGGCCACCCTAGACGCGTCTCGACGCGTTGGCCCGGGACCGGCCTTGACCTAAA
TTTGCGGGACGACGAACGAAATGGCCACCAGCTCTGCGCTCAAGCTGCTGAGGTAACCGTCTACTACTCCGCTGA
TGCCTCCATGGATCCTCCATCCGGTCGCAAGAGACAGGTCACCGAGGCAGCCTCGACGCCAGCGTCTAGCAAGCG
TCGCAGGCTGGACGATGCCAACGCCCAATCGCCGACGACGCCCCAGGCCCTAAAGACGACGGCATCGATGGCCCC
GAGCGCCTCTCCACAACCTATCGAAACCAATGGCCAGTCTGCCGCGCGGCCGGCCATCAAGCTGGCTGCTCTCAA
GGGCACCAAGTGGGATAGGGGTGATATCGGCGATGCTAGGATGTCGCGACAGCCCTCTACGCCCACGCGGGTCTC
GGCTCGGTCGTCGCCTTCTTCGAGGAGAGCGGCTTCGACTTCGAAACGTGCTGCGGGGAGGCCTTCGGGGAGGGC
GGTGGCGGAGGCTGTGGTTGATGATGGCGATGAGCTTGGCAGGTCGCCTGCCAAGTTGCGCGGGATCCTTACCCC
GTCGAAGAATCGAGTTCGTCGGCTCAAGAGCGTTACGTTTAATCGGGGCGATGAGGTTTACTTTGAAGACCTGCC
CAAGTCTGCTTCGGCTACCAAGACGCGCGCTTCCAAGGCGAAGCAGGCGAAGGCGGAGGTGGAGGAGGAGGCAGA
CGATGATGAGATTCGCTGCGGCATCTGCTCCAAGGCCGACTCCCGACCGCCCAACCAGATCATCCTCTGCGATAA
CTGCGACTTCGCCACCCACCTGGCATGTTACGATTTGCCGGATATTCCAGAGGGAGACTGGCTGTGCAAGTCTTG
CAGACAGGAAGACGCGGTGCAGATGACCAGCAAGCCCGCAACCGTACCCGACTCGGACGCGGCCGAGGTTCCCGA
CATTGCCAACCTGGATCAACACCTGCGGTCCCTCCAGCGGGTGCTGCTCGACAGGTGCTGCGGCCGGCGACGCAT
ACGCATGTGCGGGCTGGAAGAGTGCTACGACCAGGCGCGGCAGTTGGTTGAGCAGACGGTTGTTGCGGCCGAGGG
CAACTCGATGCTGCTCATCGGGCCCAGGGGCTGTGGGAAGACGACGGTGAGGTGATTTCTTGGTTGTGACGGCCA
TCATGTTGGCTGACGGCGTGTTACAGATGGTGGAGAATATGATTGTCGACTTGTCGCGAGAGCATCGACATTTAT
TTCATGTCGTTCGTCTCAGTGGCTTCATCCATACGGACGACAAGGTGGCGCTCAAGGAGATTTGGCGTCAGCTTG
GCAAGGAGATGGAGGTTGAGGATGAGCTGGTCAATCGGGTGAGTAAAGGGGCTCCCAGACGTCAAGGGATATCAC
TGACGGAGACACGCTCGTGGCAGACAAACTACGCCGACACACTGGCCTCACTACTGGCCCTCCTCTCGCACCCGT
CCGAAATCTCAGGCGCAGACACAGGCGTGACATCTCAATCCGTCATCTTCATCATCGACGAATTCGACATGTTCG
CCTGCCACGGCCGCCAAACGCTACTCTACAACCTCCTCGACATCGCGCAATCCCGCAAAGCCCCCATCGCCGTCC
TCGGCTGCACGACGCGTCTGGACGTGGTGGAGATGCTGGAGAAGAGAGTCAAGAGCCGGTTCAGCCACCGGTGCG
TCTACGTCTCGCCTCCCAGGTCGCTGGCTGCGTTCTGGCAGGTCTGTCGGCAGGGGCTGATGGTTGACTGGCATG
ACGTGGGGGCCGAGGGCATCGATGCGGGTTTGGATGGGTATGATGACTTTCATCGTTACTGGACGATGAAGATTG
AGGTGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail