Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|356
Gene name
LocationContig_11:30941..31367
Strand-
Gene length (bp)426
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4357
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3086
Ophiocordyceps australis map64 (Brazil) OphauB2|1737
Ophiocordyceps camponoti-floridani Ophcf2|05303
Ophiocordyceps camponoti-rufipedis Ophun1|356 (this protein)
Ophiocordyceps kimflemingae Ophio5|2371
Ophiocordyceps subramaniannii Hirsu2|8981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|356
MLLTDLDPDGLNIVRCYRFGADSLANDTTTHNNGIHWLGIKTHHVQAAASTTQSQQHRTSISSTTCRDPVSLLSA
RDRKLARHTLARIAARCPEADTIAEQLRLQTQTMLMMNVKAEMQWLDDAGDLTDWLDEQLVDAMYN*
Coding >Ophun1|356
ATGCTGCTAACCGACCTCGACCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGCCTCGCC
AACGACACAACAACCCACAACAACGGCATCCACTGGCTAGGCATCAAGACACATCACGTCCAAGCCGCGGCATCT
ACCACCCAAAGTCAACAGCACAGGACATCCATCTCGTCGACCACATGCCGCGACCCCGTCTCCCTCCTCAGCGCA
CGGGACCGCAAACTGGCGCGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCAGACACCATAGCAGAA
CAGCTTCGACTACAGACGCAGACGATGCTCATGATGAATGTCAAGGCCGAGATGCAGTGGCTCGACGACGCGGGG
GATTTAACCGACTGGCTGGACGAGCAGCTGGTCGACGCCATGTACAACTAG
Transcript >Ophun1|356
ATGCTGCTAACCGACCTCGACCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGCCTCGCC
AACGACACAACAACCCACAACAACGGCATCCACTGGCTAGGCATCAAGACACATCACGTCCAAGCCGCGGCATCT
ACCACCCAAAGTCAACAGCACAGGACATCCATCTCGTCGACCACATGCCGCGACCCCGTCTCCCTCCTCAGCGCA
CGGGACCGCAAACTGGCGCGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCAGACACCATAGCAGAA
CAGCTTCGACTACAGACGCAGACGATGCTCATGATGAATGTCAAGGCCGAGATGCAGTGGCTCGACGACGCGGGG
GATTTAACCGACTGGCTGGACGAGCAGCTGGTCGACGCCATGTACAACTAG
Gene >Ophun1|356
ATGCTGCTAACCGACCTCGACCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGCCTCGCC
AACGACACAACAACCCACAACAACGGCATCCACTGGCTAGGCATCAAGACACATCACGTCCAAGCCGCGGCATCT
ACCACCCAAAGTCAACAGCACAGGACATCCATCTCGTCGACCACATGCCGCGACCCCGTCTCCCTCCTCAGCGCA
CGGGACCGCAAACTGGCGCGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCAGACACCATAGCAGAA
CAGCTTCGACTACAGACGCAGACGATGCTCATGATGAATGTCAAGGCCGAGATGCAGTGGCTCGACGACGCGGGG
GATTTAACCGACTGGCTGGACGAGCAGCTGGTCGACGCCATGTACAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail