Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3556
Gene name
LocationContig_317:8613..9491
Strand-
Gene length (bp)878
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 7.1E-07 11 50
PF00646 F-box F-box domain 5.8E-05 9 42

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6928
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|3556 (this protein)
Ophiocordyceps kimflemingae Ophio5|8517
Ophiocordyceps subramaniannii Hirsu2|10357

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3556
MTSSSPLLDMLPNEVLLATLTLLSARDLAAISTVCRRFHACTGRLLRRRLHRVASLPDNELLLDCYQPSARVSTP
YLACRFQGTSGLESQGSTGISRLYSSFRPVVARDARCRWFLGPLPSQESSSSGGKDEDEAAVQTVELDEGELFSQ
LCTATNVIRQCPQPGLFISHINTCEGVIRVWRHWLAAQAIRNNDQDEDDDEGYSSGCSSPVTDGLLWVDAGQNVG
LRFRVEPASAPLLRPGPGLTPEEEEPAVAYRLVYQGGLEV*
Coding >Ophun1|3556
ATGACGTCTTCATCGCCGCTGCTCGACATGCTACCCAATGAGGTGCTCTTGGCGACTCTGACCTTGCTGTCGGCC
AGGGATCTCGCCGCTATATCAACCGTCTGCCGTCGTTTCCACGCCTGCACTGGAAGACTCCTTCGCCGACGCCTC
CATCGCGTCGCGAGCCTTCCAGATAACGAGCTGCTTCTCGACTGCTACCAGCCGAGCGCGCGCGTCTCAACGCCG
TACTTGGCCTGTCGCTTCCAAGGAACCAGCGGGCTAGAATCACAAGGATCAACAGGCATCTCGCGCCTGTACTCG
TCGTTTCGGCCCGTCGTCGCTCGAGATGCTCGCTGTCGGTGGTTCCTCGGTCCGCTCCCTTCACAGGAATCTTCC
TCTTCGGGGGGCAAAGATGAGGATGAGGCGGCGGTGCAGACGGTAGAGCTTGATGAGGGAGAGCTCTTTTCTCAG
CTGTGCACTGCTACCAATGTTATTCGTCAGTGTCCGCAGCCTGGTCTCTTCATCAGCCACATCAATACATGTGAA
GGCGTCATCCGCGTCTGGCGTCACTGGCTCGCCGCTCAGGCCATCCGAAACAACGACCAAGACGAAGACGACGAC
GAAGGCTACAGCAGCGGCTGCTCCTCTCCCGTCACCGATGGCCTTCTCTGGGTCGACGCCGGGCAGAACGTCGGG
CTGCGCTTCCGGGTGGAACCAGCCTCGGCCCCACTACTCCGGCCGGGACCGGGCTTGACCCCGGAGGAGGAAGAG
CCGGCGGTGGCGTACCGGCTTGTGTACCAGGGTGGGTTGGAGGTTTGA
Transcript >Ophun1|3556
ATGACGTCTTCATCGCCGCTGCTCGACATGCTACCCAATGAGGTGCTCTTGGCGACTCTGACCTTGCTGTCGGCC
AGGGATCTCGCCGCTATATCAACCGTCTGCCGTCGTTTCCACGCCTGCACTGGAAGACTCCTTCGCCGACGCCTC
CATCGCGTCGCGAGCCTTCCAGATAACGAGCTGCTTCTCGACTGCTACCAGCCGAGCGCGCGCGTCTCAACGCCG
TACTTGGCCTGTCGCTTCCAAGGAACCAGCGGGCTAGAATCACAAGGATCAACAGGCATCTCGCGCCTGTACTCG
TCGTTTCGGCCCGTCGTCGCTCGAGATGCTCGCTGTCGGTGGTTCCTCGGTCCGCTCCCTTCACAGGAATCTTCC
TCTTCGGGGGGCAAAGATGAGGATGAGGCGGCGGTGCAGACGGTAGAGCTTGATGAGGGAGAGCTCTTTTCTCAG
CTGTGCACTGCTACCAATGTTATTCGTCAGTGTCCGCAGCCTGGTCTCTTCATCAGCCACATCAATACATGTGAA
GGCGTCATCCGCGTCTGGCGTCACTGGCTCGCCGCTCAGGCCATCCGAAACAACGACCAAGACGAAGACGACGAC
GAAGGCTACAGCAGCGGCTGCTCCTCTCCCGTCACCGATGGCCTTCTCTGGGTCGACGCCGGGCAGAACGTCGGG
CTGCGCTTCCGGGTGGAACCAGCCTCGGCCCCACTACTCCGGCCGGGACCGGGCTTGACCCCGGAGGAGGAAGAG
CCGGCGGTGGCGTACCGGCTTGTGTACCAGGGTGGGTTGGAGGTTTGA
Gene >Ophun1|3556
ATGACGTCTTCATCGCCGCTGCTCGACATGCTACCCAATGAGGTGAGAAGACCAGAACAATGACATCAGAAAAGA
CGACTCATTGAACTGACGACGATGCCTTCACCTCAACTTCTCGGTAGGTGCTCTTGGCGACTCTGACCTTGCTGT
CGGCCAGGGATCTCGCCGCTATATCAACCGTCTGCCGTCGTTTCCACGCCTGCACTGGAAGACTCCTTCGCCGAC
GCCTCCATCGCGTCGCGAGCCTTCCAGATAACGAGCTGCTTCTCGACTGCTACCAGCCGAGCGCGCGCGTCTCAA
CGCCGTACTTGGCCTGTCGCTTCCAAGGAACCAGCGGGCTAGAATCACAAGGATCAACAGGCATCTCGCGCCTGT
ACTCGTCGTTTCGGCCCGTCGTCGCTCGAGATGCTCGCTGTCGGTGGTTCCTCGGTCCGCTCCCTTCACAGGAAT
CTTCCTCTTCGGGGGGCAAAGATGAGGATGAGGCGGCGGTGCAGACGGTAGAGCTTGATGAGGGAGAGCTCTTTT
CTCAGCTGTGCACTGCTACCAATGTTATTCGTCAGTGTCCGCAGCCTGGTCTCTTCATCAGCCACATCAATACAT
GTGAAGGCGTCATCCGCGTCTGGCGTCACTGGCTCGCCGCTCAGGCCATCCGAAACAACGACCAAGACGAAGACG
ACGACGAAGGCTACAGCAGCGGCTGCTCCTCTCCCGTCACCGATGGCCTTCTCTGGGTCGACGCCGGGCAGAACG
TCGGGCTGCGCTTCCGGGTGGAACCAGCCTCGGCCCCACTACTCCGGCCGGGACCGGGCTTGACCCCGGAGGAGG
AAGAGCCGGCGGTGGCGTACCGGCTTGTGTACCAGGGTGGGTTGGAGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail