Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3555
Gene name
LocationContig_317:6747..7458
Strand-
Gene length (bp)711
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 35 209 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 126 148 22
3 155 174 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3555
MMDWAFRNKPLATIVAEPPPVRYSPSSSLRSLSTIRSLPMTTSSHSLSFESSHPSKRPVVIKYGSGRHADVELIP
QPTDSPDDPLNWPRWKKHLNLGSLLVEVVLTGGMKTALLPTAGTLHGHVSVAALTSVPLALAALAGVASCVAAKR
LGKRPLYLASAVVCLVGCVWSAAVVDHGLASAMGARVLQGLGWGAFDTLLLGSIQDTYFVRMLSSGS*
Coding >Ophun1|3555
ATGATGGACTGGGCCTTTCGCAATAAGCCCCTGGCAACCATCGTGGCCGAGCCACCGCCCGTCCGCTACTCACCA
TCATCGTCACTCCGATCGTTAAGCACGATTCGATCACTACCCATGACGACGTCTTCCCACAGCCTCTCATTCGAA
TCCTCACACCCGAGCAAGAGACCCGTCGTCATAAAGTACGGCTCCGGCCGACACGCAGACGTCGAACTCATCCCT
CAACCCACGGACTCACCTGACGATCCGCTAAACTGGCCTCGCTGGAAGAAGCACCTCAACCTCGGCTCCCTGCTC
GTCGAAGTCGTCCTCACCGGCGGCATGAAGACGGCTCTCCTGCCCACAGCCGGGACCCTTCACGGGCACGTCTCC
GTCGCGGCTCTCACGTCGGTGCCCCTGGCGCTGGCTGCGCTGGCCGGTGTGGCCAGCTGCGTGGCCGCCAAGCGT
CTGGGCAAGCGGCCGCTGTATCTGGCTTCGGCTGTCGTCTGCCTGGTTGGCTGTGTCTGGAGCGCGGCTGTTGTT
GACCATGGCCTTGCTTCGGCTATGGGGGCGAGGGTGTTGCAGGGGTTGGGCTGGGGGGCTTTTGACACGCTGTTG
CTGGGGTCTATCCAGGACACGTACTTTGTGAGAATGCTCTCTTCTGGATCGTGA
Transcript >Ophun1|3555
ATGATGGACTGGGCCTTTCGCAATAAGCCCCTGGCAACCATCGTGGCCGAGCCACCGCCCGTCCGCTACTCACCA
TCATCGTCACTCCGATCGTTAAGCACGATTCGATCACTACCCATGACGACGTCTTCCCACAGCCTCTCATTCGAA
TCCTCACACCCGAGCAAGAGACCCGTCGTCATAAAGTACGGCTCCGGCCGACACGCAGACGTCGAACTCATCCCT
CAACCCACGGACTCACCTGACGATCCGCTAAACTGGCCTCGCTGGAAGAAGCACCTCAACCTCGGCTCCCTGCTC
GTCGAAGTCGTCCTCACCGGCGGCATGAAGACGGCTCTCCTGCCCACAGCCGGGACCCTTCACGGGCACGTCTCC
GTCGCGGCTCTCACGTCGGTGCCCCTGGCGCTGGCTGCGCTGGCCGGTGTGGCCAGCTGCGTGGCCGCCAAGCGT
CTGGGCAAGCGGCCGCTGTATCTGGCTTCGGCTGTCGTCTGCCTGGTTGGCTGTGTCTGGAGCGCGGCTGTTGTT
GACCATGGCCTTGCTTCGGCTATGGGGGCGAGGGTGTTGCAGGGGTTGGGCTGGGGGGCTTTTGACACGCTGTTG
CTGGGGTCTATCCAGGACACGTACTTTGTGAGAATGCTCTCTTCTGGATCGTGA
Gene >Ophun1|3555
ATGATGGACTGGGCCTTTCGCAATAAGCCCCTGGCAACCATCGTGGCCGAGCCACCGCCCGTCCGCTACTCACCA
TCATCGTCACTCCGATCGTTAAGCACGATTCGATCACTACCCATGACGACGTCTTCCCACAGCCTCTCATTCGAA
TCCTCACACCCGAGCAAGAGACCCGTCGTCATAAAGTACGGCTCCGGCCGACACGCAGACGTCGAACTCATCCCT
CAACCCACGGACTCACCTGACGATCCGCTAGTCTGACATCCCCCCACACAAGTAGAGACAAAGATATAGAAAACT
GACCCGTCTCAGAACTGGCCTCGCTGGAAGAAGCACCTCAACCTCGGCTCCCTGCTCGTCGAAGTCGTCCTCACC
GGCGGCATGAAGACGGCTCTCCTGCCCACAGCCGGGACCCTTCACGGGCACGTCTCCGTCGCGGCTCTCACGTCG
GTGCCCCTGGCGCTGGCTGCGCTGGCCGGTGTGGCCAGCTGCGTGGCCGCCAAGCGTCTGGGCAAGCGGCCGCTG
TATCTGGCTTCGGCTGTCGTCTGCCTGGTTGGCTGTGTCTGGAGCGCGGCTGTTGTTGACCATGGCCTTGCTTCG
GCTATGGGGGCGAGGGTGTTGCAGGGGTTGGGCTGGGGGGCTTTTGACACGCTGTTGCTGGGGTCTATCCAGGAC
ACGTACTTTGTGAGAATGCTCTCTTCTGGATCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail