Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3548
Gene name
LocationContig_316:11264..12441
Strand+
Gene length (bp)1177
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 7.4E-11 35 121
PF05368 NmrA NmrA-like family 1.2E-10 31 134
PF01370 Epimerase NAD dependent epimerase/dehydratase family 6.4E-05 32 99

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6266
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03607
Ophiocordyceps camponoti-rufipedis Ophun1|3548 (this protein)
Ophiocordyceps kimflemingae Ophio5|33
Ophiocordyceps subramaniannii Hirsu2|7989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3548
MQLKYPHSTETMTAKYAKDQPAGFINRIERVAIVGATGKVGSYMTKELLSTGKHVVTAITRKGGGSSMPKGVKVA
EVDYDREETLVEALRGQQFLVVSLSVQAPAETQDKLARAAAKAGVSWMMPNCYGTDVRNDALEKENLSGPPILAG
IAAAEKAGVSWVTMCCSFWYDYSLAMGPGWFGFDFDKKEVTMIDDGKTRINVSTWDLCGRAIKALLSLKELPDDE
ADKSVTLSRWRDQPLYISSFLISQRDMLDSIHRVQGTTDADWRIEHEESSARYKRGMALLQKGNFVGFGMCLYTR
TFYPNGDGNFGAKYGLANEALGLPEEDLDEATKRTLASLDEFRRNPVYVKAYGQS*
Coding >Ophun1|3548
ATGCAGCTTAAATACCCGCATAGCACAGAGACAATGACGGCCAAGTACGCAAAGGACCAGCCGGCCGGCTTCATC
AACCGTATCGAGCGCGTGGCCATCGTCGGGGCCACGGGCAAGGTCGGCAGTTACATGACCAAGGAGCTGCTATCG
ACCGGTAAGCATGTCGTGACGGCCATCACGCGCAAGGGAGGCGGTAGCAGTATGCCCAAGGGCGTCAAGGTGGCC
GAAGTCGACTACGACCGCGAGGAGACGCTGGTCGAGGCCCTCCGCGGACAGCAGTTCCTGGTCGTGTCGCTCTCG
GTGCAGGCGCCAGCCGAGACGCAGGACAAGCTGGCGCGGGCGGCGGCCAAGGCGGGCGTGTCGTGGATGATGCCC
AACTGCTACGGCACCGACGTGCGAAACGACGCGCTGGAAAAGGAGAACCTGTCCGGCCCTCCGATCCTAGCGGGC
ATCGCGGCGGCCGAGAAGGCGGGCGTGTCGTGGGTGACCATGTGCTGCTCGTTCTGGTACGACTATTCGCTGGCC
ATGGGACCCGGCTGGTTCGGCTTCGACTTTGATAAGAAGGAGGTGACGATGATTGACGATGGGAAGACGCGCATC
AATGTCTCTACCTGGGATTTGTGCGGCCGGGCTATCAAGGCGCTGCTGAGCCTCAAGGAGCTTCCTGACGACGAG
GCGGACAAGTCGGTGACGTTGTCTCGCTGGCGCGACCAGCCGCTATACATCTCGAGCTTCCTCATCAGCCAGCGC
GACATGTTGGACAGCATCCACCGCGTTCAGGGCACGACGGATGCCGACTGGCGCATCGAGCACGAGGAGAGCTCG
GCTCGTTATAAGCGTGGGATGGCGCTTTTGCAAAAGGGCAACTTTGTCGGCTTCGGCATGTGTCTCTATACCCGG
ACCTTTTATCCCAATGGGGACGGCAACTTTGGGGCCAAGTATGGGCTTGCTAACGAGGCGCTGGGGTTGCCTGAG
GAGGATCTGGACGAGGCGACGAAGAGGACTCTGGCTTCACTGGATGAGTTTCGGCGGAATCCGGTGTATGTGAAG
GCGTATGGTCAGTCGTGA
Transcript >Ophun1|3548
ATGCAGCTTAAATACCCGCATAGCACAGAGACAATGACGGCCAAGTACGCAAAGGACCAGCCGGCCGGCTTCATC
AACCGTATCGAGCGCGTGGCCATCGTCGGGGCCACGGGCAAGGTCGGCAGTTACATGACCAAGGAGCTGCTATCG
ACCGGTAAGCATGTCGTGACGGCCATCACGCGCAAGGGAGGCGGTAGCAGTATGCCCAAGGGCGTCAAGGTGGCC
GAAGTCGACTACGACCGCGAGGAGACGCTGGTCGAGGCCCTCCGCGGACAGCAGTTCCTGGTCGTGTCGCTCTCG
GTGCAGGCGCCAGCCGAGACGCAGGACAAGCTGGCGCGGGCGGCGGCCAAGGCGGGCGTGTCGTGGATGATGCCC
AACTGCTACGGCACCGACGTGCGAAACGACGCGCTGGAAAAGGAGAACCTGTCCGGCCCTCCGATCCTAGCGGGC
ATCGCGGCGGCCGAGAAGGCGGGCGTGTCGTGGGTGACCATGTGCTGCTCGTTCTGGTACGACTATTCGCTGGCC
ATGGGACCCGGCTGGTTCGGCTTCGACTTTGATAAGAAGGAGGTGACGATGATTGACGATGGGAAGACGCGCATC
AATGTCTCTACCTGGGATTTGTGCGGCCGGGCTATCAAGGCGCTGCTGAGCCTCAAGGAGCTTCCTGACGACGAG
GCGGACAAGTCGGTGACGTTGTCTCGCTGGCGCGACCAGCCGCTATACATCTCGAGCTTCCTCATCAGCCAGCGC
GACATGTTGGACAGCATCCACCGCGTTCAGGGCACGACGGATGCCGACTGGCGCATCGAGCACGAGGAGAGCTCG
GCTCGTTATAAGCGTGGGATGGCGCTTTTGCAAAAGGGCAACTTTGTCGGCTTCGGCATGTGTCTCTATACCCGG
ACCTTTTATCCCAATGGGGACGGCAACTTTGGGGCCAAGTATGGGCTTGCTAACGAGGCGCTGGGGTTGCCTGAG
GAGGATCTGGACGAGGCGACGAAGAGGACTCTGGCTTCACTGGATGAGTTTCGGCGGAATCCGGTGTATGTGAAG
GCGTATGGTCAGTCGTGA
Gene >Ophun1|3548
ATGCAGCTTAAATACCCGCATGTAAGACGCCCGTCCGTCTGTTACGTCGCGGGACGGGTCACATCCATCGAGGCA
GAGCACAGAGACAATGACGGCCAAGTACGCAAAGGACCAGCCGGCCGGCTTCATCAACCGTATCGAGCGCGTGGC
CATCGTCGGGGTAAGGCATTACAGCCGTCTTCGCTCCAGACAGGGGTAGAGCTGACCGACACAGGCCACGGGCAA
GGTCGGCAGTTACATGACCAAGGAGCTGCTATCGACCGGTAAGCATGTCGTGACGGCCATCACGCGCAAGGGAGG
CGGTAGCAGTATGCCCAAGGGCGTCAAGGTGGCCGAAGTCGACTACGACCGCGAGGAGACGCTGGTCGAGGCCCT
CCGCGGACAGCAGTTCCTGGTCGTGTCGCTCTCGGTGCAGGCGCCAGCCGAGACGCAGGACAAGCTGGCGCGGGC
GGCGGCCAAGGCGGGCGTGTCGTGGATGATGCCCAACTGCTACGGCACCGACGTGCGAAACGACGCGCTGGAAAA
GGAGAACCTGTCCGGCCCTCCGATCCTAGCGGGCATCGCGGCGGCCGAGAAGGCGGGCGTGTCGTGGGTGACCAT
GTGCTGCTCGTTCTGGTACGACTATTCGCTGGCCATGGGACCCGGCTGGTTCGGCTTCGACTTTGATAAGAAGGA
GGTGACGATGATTGACGATGGGAAGACGCGCATCAATGTCTCTACCTGGGATTTGTGCGGCCGGGCTATCAAGGC
GCTGCTGAGCCTCAAGGAGCTTCCTGACGACGAGGCGGACAAGTCGGTGACGTTGTCTCGCTGGCGCGACCAGCC
GCTATACATCTCGAGCTTCCTCATCAGCCAGCGCGACATGTTGGACAGCATCCACCGCGTTCAGGGCACGACGGA
TGCCGACTGGCGCATCGAGCACGAGGAGAGCTCGGCTCGTTATAAGCGTGGGATGGCGCTTTTGCAAAAGGGCAA
CTTTGTCGGCTTCGGCATGTGTCTCTATACCCGGACCTTTTATCCCAATGGGGACGGCAACTTTGGGGCCAAGTA
TGGGCTTGCTAACGAGGCGCTGGGGTTGCCTGAGGAGGATCTGGACGAGGCGACGAAGAGGACTCTGGCTTCACT
GGATGAGTTTCGGCGGAATCCGGTGTATGTGAAGGCGTATGGTCAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail