Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3533
Gene name
LocationContig_314:2965..13118
Strand-
Gene length (bp)10153
Transcript length (bp)9348
Coding sequence length (bp)9348
Protein length (aa) 3116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 1.1E-49 2786 3026
PF11640 TAN Telomere-length maintenance and DNA damage repair 3.1E-34 239 375
PF08590 DUF1771 Domain of unknown function (DUF1771) 3.8E-23 27 89
PF02260 FATC FATC domain 1.0E-09 3085 3114
PF01713 Smr Smr domain 4.3E-08 99 156
PF02259 FAT FAT domain 2.4E-08 2212 2573

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 816 3115 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 273 3115 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 747 3115 0.0E+00
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 275 3115 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 923 3115 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 816 3115 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 273 3115 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 747 3115 0.0E+00
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 275 3115 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 923 3115 0.0E+00
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 1971 3114 4.0E-175
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 1928 3114 6.0E-141
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 2012 3115 4.0E-138
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 2012 3115 7.0E-135
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 1910 3115 3.0E-133
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 2014 3114 3.0E-133
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 2014 3114 5.0E-133
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 1935 3114 2.0E-131
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 1799 3114 2.0E-124
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 245 701 1.0E-122
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 2082 3114 4.0E-113
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 2090 3114 5.0E-111
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 2090 3114 1.0E-110
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 2367 3114 2.0E-110
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 2353 3114 3.0E-108
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 2456 3111 2.0E-93
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 2587 3114 2.0E-58
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 2594 3114 4.0E-58
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 2594 3114 4.0E-58
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 2590 3114 3.0E-57
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 2587 3114 1.0E-56
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 2594 3027 2.0E-56
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 2547 3114 3.0E-56
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 2587 3114 5.0E-55
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 2484 3114 6.0E-55
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 2587 3114 1.0E-54
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 2555 3114 6.0E-52
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 2552 3019 3.0E-51
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 2588 3114 3.0E-50
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 2584 3114 3.0E-49
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 2530 3114 4.0E-46
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 2756 3114 9.0E-46
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 2596 3046 2.0E-45
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 2736 3114 4.0E-45
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 2736 3114 6.0E-45
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 2736 3114 6.0E-45
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 2735 3114 8.0E-45
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 2750 3114 2.0E-44
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 2752 3114 2.0E-44
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 2736 3114 3.0E-44
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 2757 3114 3.0E-44
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 2547 3026 2.0E-43
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 239 779 5.0E-39
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 2756 3025 1.0E-38
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 2756 3025 1.0E-38
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 2757 3026 1.0E-38
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 25 246 1.0E-36
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 2708 3024 1.0E-36
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 2728 3024 4.0E-33
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 2746 3027 2.0E-32
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 2764 3009 5.0E-31
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 2730 3041 5.0E-31
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 2757 3024 8.0E-31
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 2730 3024 1.0E-29
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 2721 3025 2.0E-29
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 2721 3025 8.0E-29
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 2757 3024 1.0E-28
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 2728 3114 2.0E-27
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 19 223 2.0E-27
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 274 724 3.0E-26
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 2908 3024 2.0E-23
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 25 149 2.0E-12
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 2756 3016 4.0E-10
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 2756 3016 5.0E-10
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 2756 3016 2.0E-09
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 2756 3016 3.0E-09
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 2766 3016 4.0E-09
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 2782 3017 4.0E-09
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 20 171 8.0E-09
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 2782 3017 8.0E-07
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 1119 1411 2.0E-06
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 2899 3016 2.0E-06
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 2899 3016 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004674 protein serine/threonine kinase activity Yes
GO:0005515 protein binding Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0003824 catalytic activity No
GO:0004672 protein kinase activity No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2256
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5386
Ophiocordyceps australis map64 (Brazil) OphauB2|2629
Ophiocordyceps camponoti-floridani Ophcf2|01951
Ophiocordyceps camponoti-rufipedis Ophun1|3533 (this protein)
Ophiocordyceps kimflemingae Ophio5|5908
Ophiocordyceps subramaniannii Hirsu2|2927

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3533
MADTTPLLRRRPALHAGDNDDIEREFDHLRSLARAEADKRNSCFDRSRQAYKSGDGAAAKALSNEGKKHDAKMDE
YNRQASEYIFRENNAPGRVEPDAIDLHGQFVEEAERILEQRIREDQARGQTHLHAIVGKGNHSAGHVQKLKPKVE
ELCRELGLRYQTEENAGRIYINLQGGEPVPPQHHPQQQQPSYHQPHHQQPHHHQPQHHQQQQQQHGHANQQDDVA
QMVEKALPRILRKLEKACCDIKSGSLRDRERALDDLAQLLRNRAANLAALEDKGYHEIFEAIFGFVLGEVRVYRD
SKLSKRNGAASRLAKCAAALRVATARGSPKLGRKTLLALVDHITELLSGPDGLIEPLVADYVKALTEVLRPSHVE
FFATKNAVPWGKCVDFLIIVAENSLPSGTLGRDSHSIAAPLRDSLRSLQYLVQAANAPSSRSQDVMDLVLRVLGL
KQLSLGSTQTACFSIINTIFASTHADDLAFANDLVRRLLPLMAYWWRTDRVSQDELIKALRNEISKTVILTHLHV
EHLAVVNWDSGVRDLVQDLLEPLWLEYSRRNEAFQLQLDDLTFCPDSLHVSNGSMRLDLFGLRHHNIEGEGPWAL
VQNLALLEAILLRPRKSQAKWANEPSSKKRRLTDSSSRLRLKLKSRDVGLQRTALQLIPFLIATCALEKADAVEL
FTELVSYVTDKNTVTVSWALIACASCAALPDLRKDHGDEWRQLWHVAARSLSLPATSRASCVLLLAILQTGLVPY
HSLAEDINGFVVTADVNGPAILCDASLSLMSRLFHERNARLPSASQATSSHVIRWVFMRWNPNESGYSSLQSLHV
SPLQFVNLLRACCGAQPVAWSGQPAISGSTLGEAWRLHEEIAPFIRYLLLLERKEVVLPSEDSGCLSTESQNSQP
TNLGNSYSSMKLTLELLCPKLEDLRSLCESWNDQTTRAGKRCSLEGFQSLLSACLISALLLPQFRQLNSAQSSKV
EAELVEIVEQGLASALSSAEPVAAIHLALRLLRCCMPDLTTDNLNHVHRDHSGLLRIMAIVASSLDRTELGFGSQ
DSDLMGIDDELDDTQVSKATTLSNSAPLPRQVQQLSINPRAFYIETKARLALFQTVHTDSSQVGLVPKAWLDSTL
SMSDDDVLSCRGLLIELSTCDLTMNSDNALDLVQRLGSIMSKSEYQSCEVALTACIEVLNGLHQLWLGDTQDLAE
SAGDFYHYFIKVALPSGVFTPRAQISMARLLFTLLRVDPDYGTKLGLNSCRTSLLYILSSGTMKVKYFIGDKIAG
IFELFILQLHDDVFVDVLENLPTDAEDTAGIAFRLLVLSRLACRWPTLLRRCIYHIFETPGKIPEATDYATWCLA
DVARELDLASPKKLFELFSRQLLYTWMENDALADIPFSIFGFDDLESLLTMAQAEAVALAMMRGQEVVSQDLARF
IGSSEKELLQRNFTTTISYCMMYADVSGGPGPMERLETVLGSQAYMAAIYTNFVDIVALCFNVVDQDSSPEKVFR
RYTDLVYAADNLKAIRDMAHSPAGLPPNQQPTFRTKFVIHNLLKLCRRTEFEFHKLWTPALAMSVIRQLFNTVHP
ALGSLHACSVLRKVRLVLCLAGPVALNTFCLEMLLNSMRGFMVDSECADDALGMTQYLLVGGSRYLRQVPSFLAG
YALSTLTSLRVFLESSQASTTQESQFKATMDKAQRFHEFFGNYLANYTSSAFRSEVHTAAFKSITQSAGLIRSSG
NAEKSMPESKLLLEILQDGASGQGLLDESSRELALRLLCGDFTLPAAIADDIVESDEEAVSYAGAVWRSCEAQKL
SPSYLAWAGRVVGRSFSASGYIPDGILRESRLRQYEEMVPGGPNRSETGLLCLLQRLASSQDPVVAGLSEVTLRT
VVSQAVLKEDAELLAACQKTLTEALFLASQWGAYRSPPSEALETPVFSDAWTEDIRSDQWLSKLSVCLAKSVPGS
ILLSALPSGLGRLRDMAEKSLPFVVHLVLSFQMKQPATKRQLSAAIKEWLGCKEPSARSNLKLLIDTILYLRTQE
YPKESSIDDRSHWLDIDYPIAAAAASRCGMYKTALLFAELAASSDSTRASRRSSQARDLDMNDTLLTIFENIDDP
DIYYGLAQDASLANVIARLEHEKEGHKCLAFRGAQFDSHLRFQSQEAEPDVRALVGTLGTIGLSGLSHSLLQTQQ
DIGSSGSVTETTYRSARRLEMWDLPAPSSSENHSVVVYKAYQSIQQAVDLPKARSAVYDGISHIMRGLTGASLNA
TGLRSRLASLASLTELDDILNAADTTGIDKVLQKFHGRCQWMRSGLYDDVSQILSCRETTTSMLSQHEDLMGSVK
LPVASLRRLQVETMLLASDIYRYHQATQESLNISTALNMLVPVCEKLGLNVDAAVKMEVASSLWEHGEMSSSIRM
LQAIDKGSSLGKQTIHVSRSELWSKIGHKVSIARLEKPHDIQKTYLEPALKELKRDGSQVEQAGAVYHQFATFCD
EQLQDADGLEDLERLQSLRKGKSDEVAELKNLVSSTKESQLRTKYAHVLAREKQWLELDEQELRRVEQTRSEFVR
LSLENYLLSLAASDEHNNDALRFTALWLERSMEDGTNKAVARHLDQVPTRKFVGLMNQLTSRLQKQESDFQKLLF
KLVLNICVDHPYHGMYQIWSGTKAKAQQKDEVAVLRVKATERVAQRLADNKAVTSVWQSVDKACKSYHGLAVEKG
KEYKSGAKVSLKESKAGQGLVACLARYSIPPPTMHLDVSASKDYSDVPHMVRLEPTMTIASGISAPKIITVVGSN
GIKYRQLVKGGHDDLRQDAIMEQVFAAVSSLLKLHRSTRQRRLGIRTYKVLPLTTASGLIEFVPNTIPLHDFLMP
AHERYHPKDLKGSQCRRELSGVQHRTVDVRVNTYRKVTERFQPVMRYFFMEKFNDPDEWFSRRLAYTRSTAAISM
LGHILGLGDRHGHNILLDTKTGEAVHIDLGVAFEAGRILPVPELVPFRLTRDIVDGMGITKTEGVFRRCCEFTLD
ALREEQYSIMTILDVLRYDPLYTWSISPVRLAKLQKARAEDDGPEASEQHAETEASKGRGGSRFNEPSEADRALE
VVRKKLSKTLSVKATVNDLINQASDERNLAVLFAGWAAYA*
Coding >Ophun1|3533
ATGGCTGACACGACCCCCCTCCTCCGCCGCCGACCAGCCCTGCACGCAGGTGACAATGACGACATCGAGCGCGAA
TTCGACCACCTGCGCAGCCTCGCCCGCGCCGAAGCCGACAAGCGAAATTCGTGTTTCGACAGGTCGCGACAAGCC
TACAAGTCCGGCGATGGCGCCGCCGCAAAGGCCCTCTCCAACGAGGGTAAGAAGCACGACGCCAAGATGGACGAG
TACAACCGCCAGGCATCGGAGTACATCTTTCGCGAGAATAACGCGCCCGGTCGCGTCGAGCCGGACGCTATTGAC
CTGCACGGCCAGTTCGTCGAGGAGGCTGAGCGCATCCTCGAGCAGCGTATACGTGAAGATCAGGCGCGCGGTCAG
ACTCATCTGCACGCCATTGTCGGAAAGGGCAACCATTCGGCTGGCCATGTGCAGAAGCTCAAGCCAAAGGTCGAG
GAGTTGTGTCGCGAGCTGGGGCTGAGGTATCAGACTGAGGAGAACGCAGGAAGGATATACATCAATCTTCAAGGG
GGTGAACCGGTGCCTCCTCAGCACCATCCGCAACAGCAGCAACCCTCATATCACCAGCCGCACCACCAACAACCT
CATCATCATCAACCTCAACATCACCAGCAGCAGCAGCAGCAGCACGGGCATGCCAACCAGCAAGACGACGTCGCC
CAAATGGTGGAAAAGGCTCTTCCTCGCATCCTGCGCAAGCTGGAAAAAGCATGCTGCGACATCAAGTCCGGCTCT
CTTCGAGATCGCGAGCGAGCGCTGGATGACTTGGCTCAGCTTCTGAGGAATAGAGCTGCTAACCTTGCCGCCTTG
GAAGATAAAGGCTATCACGAAATCTTCGAGGCCATTTTCGGCTTCGTTCTCGGCGAGGTTCGGGTTTACAGAGAC
AGCAAGCTTTCAAAGCGCAATGGGGCTGCCTCGCGACTCGCCAAGTGTGCTGCCGCCCTCAGAGTGGCAACGGCT
CGAGGTTCTCCCAAGCTGGGACGCAAGACTCTACTCGCCCTAGTAGATCACATCACGGAGCTTCTGTCGGGCCCG
GACGGCCTCATCGAGCCGCTCGTGGCGGACTACGTCAAAGCTCTGACCGAAGTGCTTCGGCCATCTCACGTTGAA
TTCTTCGCCACAAAGAATGCTGTGCCCTGGGGAAAATGCGTCGACTTTCTCATTATAGTCGCAGAGAACAGCCTG
CCGTCCGGGACACTTGGTCGGGACTCGCATTCCATCGCCGCTCCGTTGCGTGACTCTCTCAGAAGCTTGCAATAC
CTAGTTCAGGCGGCGAATGCTCCTTCAAGTCGGTCACAGGATGTCATGGACCTTGTGCTTCGAGTATTGGGCCTC
AAGCAGCTCAGTCTTGGCTCCACACAGACGGCCTGCTTCTCCATCATCAACACCATCTTTGCCTCAACGCATGCC
GACGACCTTGCGTTCGCAAATGATCTCGTCAGGCGTCTCTTGCCCTTGATGGCATACTGGTGGCGTACCGACAGA
GTATCCCAGGACGAGCTCATCAAGGCCTTGAGGAACGAAATCTCAAAGACGGTGATTTTGACTCATCTACATGTG
GAGCACCTAGCCGTCGTCAATTGGGACTCTGGCGTGCGCGATCTTGTCCAAGACTTGCTAGAGCCCCTGTGGCTT
GAATACTCCAGACGAAACGAGGCATTCCAGCTGCAACTCGACGACCTCACGTTCTGTCCGGACTCGTTACATGTA
TCCAACGGCTCCATGCGGCTCGACCTTTTTGGACTTCGTCACCACAATATCGAGGGTGAAGGTCCCTGGGCTCTG
GTCCAGAATTTGGCTCTATTAGAAGCAATCCTCTTGCGACCAAGGAAGAGTCAAGCCAAATGGGCCAACGAACCA
AGCTCCAAGAAACGGCGACTGACGGACAGCTCAAGCCGTCTGAGACTGAAGCTCAAGTCGAGAGACGTCGGTCTG
CAGCGAACCGCTCTTCAACTAATCCCCTTTTTAATCGCCACCTGTGCTCTGGAGAAGGCAGATGCAGTGGAACTG
TTCACTGAGCTCGTGTCTTATGTCACAGATAAGAATACTGTGACTGTGTCTTGGGCATTGATCGCCTGCGCAAGT
TGCGCTGCGTTGCCGGATCTGCGCAAGGATCATGGCGATGAATGGAGACAGCTTTGGCACGTGGCGGCCAGATCT
CTCAGTCTTCCAGCGACCAGTCGTGCGTCCTGTGTTCTACTGCTTGCCATCTTGCAGACAGGTCTTGTGCCATAT
CACTCTCTCGCTGAGGACATCAACGGCTTTGTCGTCACAGCTGATGTGAACGGGCCCGCGATTCTTTGCGACGCG
TCCTTGTCACTAATGTCTCGTCTATTTCACGAGCGCAACGCCAGGCTTCCGAGCGCCAGCCAAGCCACGAGCAGC
CACGTTATAAGATGGGTTTTCATGAGATGGAACCCGAACGAGTCAGGCTACTCCTCCTTGCAGTCGCTTCACGTC
TCGCCGTTACAGTTTGTCAATCTTCTGCGAGCGTGCTGTGGCGCGCAACCCGTGGCTTGGAGCGGCCAGCCCGCG
ATCTCTGGTTCGACCCTTGGCGAAGCATGGAGGCTGCATGAAGAGATTGCCCCCTTCATCCGATATCTTTTACTT
CTTGAGCGCAAAGAGGTTGTATTGCCGTCCGAGGACAGCGGTTGCTTATCAACGGAAAGCCAGAACTCGCAACCA
ACGAACTTGGGGAACTCCTACTCGTCGATGAAACTGACTTTGGAGCTGTTGTGTCCGAAGCTGGAAGACCTGCGC
TCCTTGTGCGAGTCTTGGAACGACCAGACAACTCGGGCCGGCAAACGATGCTCTCTCGAAGGATTCCAGAGTCTG
TTGTCGGCGTGTCTCATCAGCGCCTTGCTTTTGCCGCAATTCAGACAGTTGAACTCTGCACAGTCGTCCAAAGTC
GAAGCAGAATTGGTTGAAATCGTCGAACAAGGCCTGGCATCCGCCCTAAGTTCAGCCGAGCCCGTGGCAGCAATT
CATCTGGCCTTGCGACTCTTGCGATGCTGTATGCCGGACCTCACTACGGACAACCTCAATCATGTTCACCGAGAT
CATTCCGGCCTCCTCCGCATCATGGCCATTGTTGCTAGCTCACTGGATAGGACAGAGCTGGGATTTGGCTCTCAG
GATTCAGACTTGATGGGAATTGACGATGAACTCGACGACACCCAAGTCAGCAAGGCCACGACCTTGTCAAACTCC
GCTCCCTTGCCGAGGCAAGTCCAGCAACTGTCCATTAACCCCCGAGCATTCTACATCGAGACAAAGGCCCGTCTG
GCTCTGTTCCAGACAGTTCATACGGACAGCAGCCAGGTCGGCCTGGTTCCCAAAGCCTGGCTCGATAGCACCCTG
TCCATGTCGGACGACGATGTGCTGTCGTGTCGCGGCCTGTTGATTGAACTCTCGACATGCGACCTCACCATGAAT
TCAGACAACGCGTTGGACTTGGTTCAGCGACTGGGCTCCATCATGAGTAAATCCGAATATCAGTCCTGCGAGGTT
GCGCTCACCGCCTGCATCGAGGTCCTCAACGGCCTCCATCAGCTGTGGCTTGGGGATACCCAGGATCTCGCGGAG
AGTGCGGGCGACTTCTATCACTACTTCATCAAAGTCGCCCTGCCGTCGGGCGTTTTTACTCCCAGGGCGCAGATA
TCCATGGCCCGTCTGCTCTTTACGCTCCTCCGCGTCGATCCAGACTACGGCACGAAACTCGGGCTCAACTCATGT
CGGACGTCACTGTTATACATTCTCAGCAGCGGGACTATGAAGGTGAAATACTTCATTGGCGATAAGATCGCCGGC
ATCTTCGAGCTGTTTATTCTGCAACTGCACGACGACGTCTTCGTCGACGTACTGGAGAACCTGCCAACGGATGCT
GAAGACACTGCCGGTATCGCGTTCCGGCTGCTCGTTCTTTCAAGGCTGGCATGCCGGTGGCCAACTTTGCTGCGA
AGATGTATATATCACATCTTTGAGACGCCTGGCAAGATACCCGAAGCGACCGACTATGCCACCTGGTGTCTGGCG
GACGTTGCTCGTGAATTGGACCTTGCTTCGCCGAAGAAGCTGTTCGAACTCTTCTCGCGCCAGCTCCTGTACACA
TGGATGGAGAACGACGCATTGGCAGACATACCGTTCAGCATCTTTGGGTTCGACGATCTGGAAAGCCTGCTGACT
ATGGCTCAAGCTGAGGCGGTTGCGCTGGCCATGATGCGAGGCCAAGAGGTTGTGAGCCAAGACCTGGCTCGGTTC
ATCGGGTCGAGCGAGAAAGAGCTGCTGCAGCGCAATTTCACGACAACAATCTCGTACTGCATGATGTACGCCGAT
GTTTCTGGCGGACCCGGCCCCATGGAAAGACTCGAGACGGTTCTGGGGAGCCAGGCCTACATGGCGGCCATCTAT
ACCAACTTCGTGGACATTGTCGCCCTTTGTTTCAATGTTGTCGACCAGGACAGCTCGCCTGAGAAAGTGTTTCGT
AGATACACTGATCTCGTCTACGCTGCTGATAACCTGAAAGCCATCAGGGACATGGCTCACTCGCCCGCAGGGCTA
CCCCCGAACCAGCAGCCAACATTCAGGACCAAGTTTGTGATTCACAACCTGCTAAAGCTTTGTCGAAGAACCGAG
TTCGAGTTCCACAAGCTCTGGACACCGGCTCTGGCCATGTCGGTCATCAGACAGCTCTTCAACACCGTCCATCCA
GCGCTGGGCTCCCTACACGCCTGCTCTGTTCTCAGAAAGGTCCGGCTTGTGCTATGTCTGGCGGGGCCTGTGGCA
TTGAACACATTCTGTCTTGAGATGCTTCTGAACTCGATGCGCGGCTTCATGGTCGACTCGGAATGCGCCGACGAT
GCCCTTGGCATGACCCAATATCTTCTTGTTGGAGGATCCCGGTACTTGAGACAGGTGCCTTCGTTCCTGGCTGGC
TATGCCCTTTCCACCTTGACCTCCCTCCGCGTCTTTCTCGAATCGAGCCAGGCGAGCACAACTCAGGAAAGCCAG
TTCAAGGCGACAATGGACAAGGCACAAAGATTTCACGAGTTTTTCGGAAACTACCTGGCCAACTACACCTCGTCA
GCGTTCCGGAGCGAGGTTCACACTGCCGCCTTCAAGTCTATCACGCAATCCGCAGGTCTCATCAGATCATCCGGG
AACGCAGAGAAGAGCATGCCGGAAAGCAAGCTGCTGCTGGAAATCTTGCAGGATGGCGCCTCAGGGCAGGGACTG
TTGGACGAGTCGTCTCGTGAGCTCGCTTTGAGATTGCTCTGTGGGGACTTCACGTTACCCGCGGCTATTGCGGAC
GACATCGTGGAGAGCGACGAAGAAGCAGTTTCCTACGCCGGCGCCGTGTGGAGAAGCTGTGAAGCCCAGAAGCTC
AGCCCCAGCTACCTGGCCTGGGCCGGCCGAGTTGTTGGACGATCCTTTTCAGCTTCGGGCTACATCCCGGACGGA
ATATTGCGCGAGTCTCGGCTTCGTCAATATGAGGAGATGGTTCCTGGAGGACCGAACAGATCGGAAACGGGCCTG
CTCTGTCTCCTTCAGCGTCTTGCTTCGAGCCAGGATCCGGTCGTAGCAGGCCTATCCGAGGTTACCCTGAGGACG
GTCGTCTCCCAGGCCGTCTTGAAAGAGGATGCAGAGCTTCTAGCCGCCTGTCAGAAGACCTTGACGGAAGCCTTG
TTCCTTGCCTCCCAATGGGGGGCTTATCGGTCTCCCCCCTCGGAAGCGCTGGAGACTCCCGTCTTTTCAGATGCG
TGGACAGAAGACATCAGATCCGACCAATGGCTTTCGAAGCTCAGTGTTTGTTTGGCAAAATCTGTGCCGGGCTCG
ATTCTTCTCTCTGCCCTCCCATCGGGCCTGGGAAGGCTGAGAGATATGGCCGAGAAATCGCTCCCCTTTGTGGTT
CACCTAGTCCTTTCTTTCCAGATGAAGCAGCCGGCCACTAAGCGTCAACTGTCGGCGGCGATCAAGGAGTGGCTT
GGCTGCAAGGAACCCTCCGCGAGGAGCAACCTGAAGCTCCTGATCGACACGATTCTCTATCTGAGGACCCAGGAA
TACCCAAAGGAGTCATCGATTGACGATCGATCACATTGGCTGGATATCGACTACCCCATCGCAGCGGCAGCGGCT
TCGCGATGCGGCATGTACAAGACTGCTCTCCTGTTTGCCGAGCTTGCCGCCTCCTCAGACAGCACACGCGCGTCC
CGCAGGTCGTCTCAGGCACGAGATTTGGACATGAACGACACTCTCCTCACCATCTTTGAGAATATCGACGATCCT
GACATTTACTACGGCCTCGCCCAAGACGCGAGTCTCGCCAACGTCATCGCTCGTTTAGAGCACGAGAAGGAGGGT
CACAAGTGTCTCGCGTTTCGAGGAGCGCAATTCGACAGTCACCTTCGATTTCAGAGCCAGGAAGCAGAGCCAGAC
GTTCGGGCCTTGGTAGGGACCCTCGGCACAATTGGTCTGTCGGGACTCTCCCACTCGCTGCTCCAGACGCAGCAG
GATATCGGCTCATCAGGCTCGGTGACGGAGACGACTTATCGATCAGCGAGGCGACTGGAGATGTGGGATCTTCCT
GCGCCGTCTTCCTCCGAGAACCACAGCGTTGTCGTTTACAAGGCATACCAAAGCATACAGCAGGCGGTGGATCTA
CCGAAAGCCCGATCGGCGGTCTATGACGGCATCAGTCACATCATGAGAGGCCTGACTGGGGCCAGTCTCAACGCA
ACGGGGCTGAGGAGCCGCTTGGCTTCACTGGCGTCGCTCACGGAGCTGGACGATATCCTCAACGCTGCGGATACG
ACCGGGATTGACAAGGTGCTGCAAAAGTTCCACGGCCGGTGTCAATGGATGAGAAGCGGACTCTACGACGACGTG
AGTCAAATCTTGTCGTGTCGAGAGACGACGACAAGCATGTTGAGCCAACACGAGGACCTCATGGGCAGCGTCAAG
CTCCCCGTCGCCTCGCTGAGGCGGCTGCAAGTAGAAACGATGCTGCTGGCGTCTGACATCTACCGCTACCATCAG
GCGACGCAGGAGTCGCTCAATATCTCGACTGCGCTCAACATGCTAGTGCCCGTGTGCGAGAAGCTCGGCCTCAAT
GTCGATGCAGCGGTCAAGATGGAAGTGGCCAGCTCGCTGTGGGAGCACGGGGAGATGAGCAGCAGCATCCGGATG
CTTCAGGCCATCGACAAGGGCTCTTCTCTCGGGAAGCAGACGATCCATGTAAGCCGATCGGAGCTGTGGTCCAAG
ATCGGGCACAAGGTGTCGATTGCGCGGCTGGAGAAGCCTCACGACATCCAAAAGACGTACTTGGAGCCGGCGCTC
AAGGAGCTCAAGCGGGATGGCAGCCAAGTCGAACAGGCAGGCGCTGTGTATCATCAATTTGCCACATTCTGCGAC
GAGCAGCTGCAGGACGCCGACGGACTTGAGGATCTGGAGAGGCTGCAAAGCCTGCGGAAAGGGAAGAGTGACGAG
GTGGCTGAGCTCAAGAATCTGGTTTCGTCGACCAAGGAGTCTCAGCTTCGGACCAAGTACGCTCACGTGCTGGCG
AGAGAGAAGCAATGGCTAGAGCTGGACGAGCAGGAGCTGCGACGGGTCGAGCAGACGCGAAGCGAATTCGTACGG
CTCAGCCTGGAGAATTACTTGCTATCGCTCGCAGCGTCAGACGAGCACAACAACGACGCGCTGCGGTTCACGGCT
CTCTGGCTGGAGCGGTCCATGGAAGACGGAACGAACAAGGCGGTGGCTCGTCACCTGGACCAAGTGCCGACGAGG
AAGTTTGTCGGTCTGATGAACCAATTGACCTCGCGATTGCAGAAGCAGGAGTCAGACTTTCAGAAGCTGCTGTTC
AAGCTCGTGCTGAATATCTGCGTCGATCATCCCTACCACGGTATGTACCAGATCTGGTCGGGGACAAAAGCCAAG
GCGCAGCAGAAGGATGAGGTCGCGGTGCTTCGCGTCAAGGCGACGGAAAGGGTGGCTCAGCGGCTGGCCGATAAC
AAGGCTGTGACCAGCGTGTGGCAGTCGGTGGACAAGGCCTGCAAAAGCTATCATGGACTGGCGGTGGAAAAGGGC
AAGGAGTACAAGTCAGGGGCCAAGGTGTCCCTCAAGGAATCCAAGGCTGGACAGGGCCTCGTGGCGTGTCTGGCA
CGGTACAGCATCCCTCCACCTACGATGCATCTGGACGTGTCGGCCAGCAAGGACTACTCGGACGTTCCGCACATG
GTGAGGCTGGAGCCGACGATGACGATCGCGTCGGGCATCAGCGCGCCCAAGATCATCACCGTGGTGGGCAGCAAC
GGCATCAAGTACAGGCAGCTGGTCAAGGGCGGACACGACGATCTGCGGCAGGACGCCATCATGGAGCAGGTCTTT
GCAGCCGTCTCGTCGCTGCTCAAGCTTCACCGCAGCACGCGGCAGAGGAGGCTTGGGATCCGGACGTACAAGGTG
CTGCCCCTGACGACGGCGTCTGGGCTCATCGAGTTCGTGCCCAACACCATCCCCTTGCACGATTTCTTGATGCCG
GCGCACGAGCGGTATCATCCCAAGGACCTCAAGGGGTCGCAGTGCAGGCGAGAGCTCTCGGGGGTTCAGCACCGG
ACAGTTGACGTACGTGTCAACACGTATCGAAAGGTGACGGAAAGATTCCAGCCGGTGATGCGGTATTTCTTCATG
GAGAAGTTCAACGACCCGGACGAATGGTTCAGCCGGCGTCTGGCCTACACGCGGAGCACGGCCGCCATCTCGATG
CTGGGCCACATCCTGGGACTCGGAGACCGACACGGACACAACATCCTGCTCGACACCAAGACGGGCGAGGCGGTG
CATATCGACCTCGGAGTGGCCTTTGAGGCGGGTCGAATCCTGCCGGTGCCGGAGCTGGTACCGTTTCGCCTGACG
CGGGATATTGTCGACGGCATGGGCATCACCAAGACGGAGGGCGTCTTCCGTCGCTGCTGTGAGTTTACGCTGGAT
GCGTTGCGGGAGGAGCAGTATTCTATCATGACGATCCTCGACGTGTTGCGATACGATCCGCTTTACACCTGGTCC
ATCTCGCCCGTGCGGCTGGCCAAGCTGCAAAAGGCCCGGGCCGAGGACGACGGCCCAGAGGCATCGGAGCAACAC
GCGGAGACCGAGGCCAGCAAGGGGAGGGGAGGCAGCCGGTTCAACGAGCCGTCAGAGGCGGACCGGGCGCTCGAG
GTGGTGCGGAAGAAGCTGTCCAAGACGCTGAGCGTCAAGGCGACGGTCAACGATCTCATCAACCAGGCCAGCGAT
GAGAGGAACTTGGCTGTTTTGTTTGCGGGGTGGGCAGCGTACGCCTAG
Transcript >Ophun1|3533
ATGGCTGACACGACCCCCCTCCTCCGCCGCCGACCAGCCCTGCACGCAGGTGACAATGACGACATCGAGCGCGAA
TTCGACCACCTGCGCAGCCTCGCCCGCGCCGAAGCCGACAAGCGAAATTCGTGTTTCGACAGGTCGCGACAAGCC
TACAAGTCCGGCGATGGCGCCGCCGCAAAGGCCCTCTCCAACGAGGGTAAGAAGCACGACGCCAAGATGGACGAG
TACAACCGCCAGGCATCGGAGTACATCTTTCGCGAGAATAACGCGCCCGGTCGCGTCGAGCCGGACGCTATTGAC
CTGCACGGCCAGTTCGTCGAGGAGGCTGAGCGCATCCTCGAGCAGCGTATACGTGAAGATCAGGCGCGCGGTCAG
ACTCATCTGCACGCCATTGTCGGAAAGGGCAACCATTCGGCTGGCCATGTGCAGAAGCTCAAGCCAAAGGTCGAG
GAGTTGTGTCGCGAGCTGGGGCTGAGGTATCAGACTGAGGAGAACGCAGGAAGGATATACATCAATCTTCAAGGG
GGTGAACCGGTGCCTCCTCAGCACCATCCGCAACAGCAGCAACCCTCATATCACCAGCCGCACCACCAACAACCT
CATCATCATCAACCTCAACATCACCAGCAGCAGCAGCAGCAGCACGGGCATGCCAACCAGCAAGACGACGTCGCC
CAAATGGTGGAAAAGGCTCTTCCTCGCATCCTGCGCAAGCTGGAAAAAGCATGCTGCGACATCAAGTCCGGCTCT
CTTCGAGATCGCGAGCGAGCGCTGGATGACTTGGCTCAGCTTCTGAGGAATAGAGCTGCTAACCTTGCCGCCTTG
GAAGATAAAGGCTATCACGAAATCTTCGAGGCCATTTTCGGCTTCGTTCTCGGCGAGGTTCGGGTTTACAGAGAC
AGCAAGCTTTCAAAGCGCAATGGGGCTGCCTCGCGACTCGCCAAGTGTGCTGCCGCCCTCAGAGTGGCAACGGCT
CGAGGTTCTCCCAAGCTGGGACGCAAGACTCTACTCGCCCTAGTAGATCACATCACGGAGCTTCTGTCGGGCCCG
GACGGCCTCATCGAGCCGCTCGTGGCGGACTACGTCAAAGCTCTGACCGAAGTGCTTCGGCCATCTCACGTTGAA
TTCTTCGCCACAAAGAATGCTGTGCCCTGGGGAAAATGCGTCGACTTTCTCATTATAGTCGCAGAGAACAGCCTG
CCGTCCGGGACACTTGGTCGGGACTCGCATTCCATCGCCGCTCCGTTGCGTGACTCTCTCAGAAGCTTGCAATAC
CTAGTTCAGGCGGCGAATGCTCCTTCAAGTCGGTCACAGGATGTCATGGACCTTGTGCTTCGAGTATTGGGCCTC
AAGCAGCTCAGTCTTGGCTCCACACAGACGGCCTGCTTCTCCATCATCAACACCATCTTTGCCTCAACGCATGCC
GACGACCTTGCGTTCGCAAATGATCTCGTCAGGCGTCTCTTGCCCTTGATGGCATACTGGTGGCGTACCGACAGA
GTATCCCAGGACGAGCTCATCAAGGCCTTGAGGAACGAAATCTCAAAGACGGTGATTTTGACTCATCTACATGTG
GAGCACCTAGCCGTCGTCAATTGGGACTCTGGCGTGCGCGATCTTGTCCAAGACTTGCTAGAGCCCCTGTGGCTT
GAATACTCCAGACGAAACGAGGCATTCCAGCTGCAACTCGACGACCTCACGTTCTGTCCGGACTCGTTACATGTA
TCCAACGGCTCCATGCGGCTCGACCTTTTTGGACTTCGTCACCACAATATCGAGGGTGAAGGTCCCTGGGCTCTG
GTCCAGAATTTGGCTCTATTAGAAGCAATCCTCTTGCGACCAAGGAAGAGTCAAGCCAAATGGGCCAACGAACCA
AGCTCCAAGAAACGGCGACTGACGGACAGCTCAAGCCGTCTGAGACTGAAGCTCAAGTCGAGAGACGTCGGTCTG
CAGCGAACCGCTCTTCAACTAATCCCCTTTTTAATCGCCACCTGTGCTCTGGAGAAGGCAGATGCAGTGGAACTG
TTCACTGAGCTCGTGTCTTATGTCACAGATAAGAATACTGTGACTGTGTCTTGGGCATTGATCGCCTGCGCAAGT
TGCGCTGCGTTGCCGGATCTGCGCAAGGATCATGGCGATGAATGGAGACAGCTTTGGCACGTGGCGGCCAGATCT
CTCAGTCTTCCAGCGACCAGTCGTGCGTCCTGTGTTCTACTGCTTGCCATCTTGCAGACAGGTCTTGTGCCATAT
CACTCTCTCGCTGAGGACATCAACGGCTTTGTCGTCACAGCTGATGTGAACGGGCCCGCGATTCTTTGCGACGCG
TCCTTGTCACTAATGTCTCGTCTATTTCACGAGCGCAACGCCAGGCTTCCGAGCGCCAGCCAAGCCACGAGCAGC
CACGTTATAAGATGGGTTTTCATGAGATGGAACCCGAACGAGTCAGGCTACTCCTCCTTGCAGTCGCTTCACGTC
TCGCCGTTACAGTTTGTCAATCTTCTGCGAGCGTGCTGTGGCGCGCAACCCGTGGCTTGGAGCGGCCAGCCCGCG
ATCTCTGGTTCGACCCTTGGCGAAGCATGGAGGCTGCATGAAGAGATTGCCCCCTTCATCCGATATCTTTTACTT
CTTGAGCGCAAAGAGGTTGTATTGCCGTCCGAGGACAGCGGTTGCTTATCAACGGAAAGCCAGAACTCGCAACCA
ACGAACTTGGGGAACTCCTACTCGTCGATGAAACTGACTTTGGAGCTGTTGTGTCCGAAGCTGGAAGACCTGCGC
TCCTTGTGCGAGTCTTGGAACGACCAGACAACTCGGGCCGGCAAACGATGCTCTCTCGAAGGATTCCAGAGTCTG
TTGTCGGCGTGTCTCATCAGCGCCTTGCTTTTGCCGCAATTCAGACAGTTGAACTCTGCACAGTCGTCCAAAGTC
GAAGCAGAATTGGTTGAAATCGTCGAACAAGGCCTGGCATCCGCCCTAAGTTCAGCCGAGCCCGTGGCAGCAATT
CATCTGGCCTTGCGACTCTTGCGATGCTGTATGCCGGACCTCACTACGGACAACCTCAATCATGTTCACCGAGAT
CATTCCGGCCTCCTCCGCATCATGGCCATTGTTGCTAGCTCACTGGATAGGACAGAGCTGGGATTTGGCTCTCAG
GATTCAGACTTGATGGGAATTGACGATGAACTCGACGACACCCAAGTCAGCAAGGCCACGACCTTGTCAAACTCC
GCTCCCTTGCCGAGGCAAGTCCAGCAACTGTCCATTAACCCCCGAGCATTCTACATCGAGACAAAGGCCCGTCTG
GCTCTGTTCCAGACAGTTCATACGGACAGCAGCCAGGTCGGCCTGGTTCCCAAAGCCTGGCTCGATAGCACCCTG
TCCATGTCGGACGACGATGTGCTGTCGTGTCGCGGCCTGTTGATTGAACTCTCGACATGCGACCTCACCATGAAT
TCAGACAACGCGTTGGACTTGGTTCAGCGACTGGGCTCCATCATGAGTAAATCCGAATATCAGTCCTGCGAGGTT
GCGCTCACCGCCTGCATCGAGGTCCTCAACGGCCTCCATCAGCTGTGGCTTGGGGATACCCAGGATCTCGCGGAG
AGTGCGGGCGACTTCTATCACTACTTCATCAAAGTCGCCCTGCCGTCGGGCGTTTTTACTCCCAGGGCGCAGATA
TCCATGGCCCGTCTGCTCTTTACGCTCCTCCGCGTCGATCCAGACTACGGCACGAAACTCGGGCTCAACTCATGT
CGGACGTCACTGTTATACATTCTCAGCAGCGGGACTATGAAGGTGAAATACTTCATTGGCGATAAGATCGCCGGC
ATCTTCGAGCTGTTTATTCTGCAACTGCACGACGACGTCTTCGTCGACGTACTGGAGAACCTGCCAACGGATGCT
GAAGACACTGCCGGTATCGCGTTCCGGCTGCTCGTTCTTTCAAGGCTGGCATGCCGGTGGCCAACTTTGCTGCGA
AGATGTATATATCACATCTTTGAGACGCCTGGCAAGATACCCGAAGCGACCGACTATGCCACCTGGTGTCTGGCG
GACGTTGCTCGTGAATTGGACCTTGCTTCGCCGAAGAAGCTGTTCGAACTCTTCTCGCGCCAGCTCCTGTACACA
TGGATGGAGAACGACGCATTGGCAGACATACCGTTCAGCATCTTTGGGTTCGACGATCTGGAAAGCCTGCTGACT
ATGGCTCAAGCTGAGGCGGTTGCGCTGGCCATGATGCGAGGCCAAGAGGTTGTGAGCCAAGACCTGGCTCGGTTC
ATCGGGTCGAGCGAGAAAGAGCTGCTGCAGCGCAATTTCACGACAACAATCTCGTACTGCATGATGTACGCCGAT
GTTTCTGGCGGACCCGGCCCCATGGAAAGACTCGAGACGGTTCTGGGGAGCCAGGCCTACATGGCGGCCATCTAT
ACCAACTTCGTGGACATTGTCGCCCTTTGTTTCAATGTTGTCGACCAGGACAGCTCGCCTGAGAAAGTGTTTCGT
AGATACACTGATCTCGTCTACGCTGCTGATAACCTGAAAGCCATCAGGGACATGGCTCACTCGCCCGCAGGGCTA
CCCCCGAACCAGCAGCCAACATTCAGGACCAAGTTTGTGATTCACAACCTGCTAAAGCTTTGTCGAAGAACCGAG
TTCGAGTTCCACAAGCTCTGGACACCGGCTCTGGCCATGTCGGTCATCAGACAGCTCTTCAACACCGTCCATCCA
GCGCTGGGCTCCCTACACGCCTGCTCTGTTCTCAGAAAGGTCCGGCTTGTGCTATGTCTGGCGGGGCCTGTGGCA
TTGAACACATTCTGTCTTGAGATGCTTCTGAACTCGATGCGCGGCTTCATGGTCGACTCGGAATGCGCCGACGAT
GCCCTTGGCATGACCCAATATCTTCTTGTTGGAGGATCCCGGTACTTGAGACAGGTGCCTTCGTTCCTGGCTGGC
TATGCCCTTTCCACCTTGACCTCCCTCCGCGTCTTTCTCGAATCGAGCCAGGCGAGCACAACTCAGGAAAGCCAG
TTCAAGGCGACAATGGACAAGGCACAAAGATTTCACGAGTTTTTCGGAAACTACCTGGCCAACTACACCTCGTCA
GCGTTCCGGAGCGAGGTTCACACTGCCGCCTTCAAGTCTATCACGCAATCCGCAGGTCTCATCAGATCATCCGGG
AACGCAGAGAAGAGCATGCCGGAAAGCAAGCTGCTGCTGGAAATCTTGCAGGATGGCGCCTCAGGGCAGGGACTG
TTGGACGAGTCGTCTCGTGAGCTCGCTTTGAGATTGCTCTGTGGGGACTTCACGTTACCCGCGGCTATTGCGGAC
GACATCGTGGAGAGCGACGAAGAAGCAGTTTCCTACGCCGGCGCCGTGTGGAGAAGCTGTGAAGCCCAGAAGCTC
AGCCCCAGCTACCTGGCCTGGGCCGGCCGAGTTGTTGGACGATCCTTTTCAGCTTCGGGCTACATCCCGGACGGA
ATATTGCGCGAGTCTCGGCTTCGTCAATATGAGGAGATGGTTCCTGGAGGACCGAACAGATCGGAAACGGGCCTG
CTCTGTCTCCTTCAGCGTCTTGCTTCGAGCCAGGATCCGGTCGTAGCAGGCCTATCCGAGGTTACCCTGAGGACG
GTCGTCTCCCAGGCCGTCTTGAAAGAGGATGCAGAGCTTCTAGCCGCCTGTCAGAAGACCTTGACGGAAGCCTTG
TTCCTTGCCTCCCAATGGGGGGCTTATCGGTCTCCCCCCTCGGAAGCGCTGGAGACTCCCGTCTTTTCAGATGCG
TGGACAGAAGACATCAGATCCGACCAATGGCTTTCGAAGCTCAGTGTTTGTTTGGCAAAATCTGTGCCGGGCTCG
ATTCTTCTCTCTGCCCTCCCATCGGGCCTGGGAAGGCTGAGAGATATGGCCGAGAAATCGCTCCCCTTTGTGGTT
CACCTAGTCCTTTCTTTCCAGATGAAGCAGCCGGCCACTAAGCGTCAACTGTCGGCGGCGATCAAGGAGTGGCTT
GGCTGCAAGGAACCCTCCGCGAGGAGCAACCTGAAGCTCCTGATCGACACGATTCTCTATCTGAGGACCCAGGAA
TACCCAAAGGAGTCATCGATTGACGATCGATCACATTGGCTGGATATCGACTACCCCATCGCAGCGGCAGCGGCT
TCGCGATGCGGCATGTACAAGACTGCTCTCCTGTTTGCCGAGCTTGCCGCCTCCTCAGACAGCACACGCGCGTCC
CGCAGGTCGTCTCAGGCACGAGATTTGGACATGAACGACACTCTCCTCACCATCTTTGAGAATATCGACGATCCT
GACATTTACTACGGCCTCGCCCAAGACGCGAGTCTCGCCAACGTCATCGCTCGTTTAGAGCACGAGAAGGAGGGT
CACAAGTGTCTCGCGTTTCGAGGAGCGCAATTCGACAGTCACCTTCGATTTCAGAGCCAGGAAGCAGAGCCAGAC
GTTCGGGCCTTGGTAGGGACCCTCGGCACAATTGGTCTGTCGGGACTCTCCCACTCGCTGCTCCAGACGCAGCAG
GATATCGGCTCATCAGGCTCGGTGACGGAGACGACTTATCGATCAGCGAGGCGACTGGAGATGTGGGATCTTCCT
GCGCCGTCTTCCTCCGAGAACCACAGCGTTGTCGTTTACAAGGCATACCAAAGCATACAGCAGGCGGTGGATCTA
CCGAAAGCCCGATCGGCGGTCTATGACGGCATCAGTCACATCATGAGAGGCCTGACTGGGGCCAGTCTCAACGCA
ACGGGGCTGAGGAGCCGCTTGGCTTCACTGGCGTCGCTCACGGAGCTGGACGATATCCTCAACGCTGCGGATACG
ACCGGGATTGACAAGGTGCTGCAAAAGTTCCACGGCCGGTGTCAATGGATGAGAAGCGGACTCTACGACGACGTG
AGTCAAATCTTGTCGTGTCGAGAGACGACGACAAGCATGTTGAGCCAACACGAGGACCTCATGGGCAGCGTCAAG
CTCCCCGTCGCCTCGCTGAGGCGGCTGCAAGTAGAAACGATGCTGCTGGCGTCTGACATCTACCGCTACCATCAG
GCGACGCAGGAGTCGCTCAATATCTCGACTGCGCTCAACATGCTAGTGCCCGTGTGCGAGAAGCTCGGCCTCAAT
GTCGATGCAGCGGTCAAGATGGAAGTGGCCAGCTCGCTGTGGGAGCACGGGGAGATGAGCAGCAGCATCCGGATG
CTTCAGGCCATCGACAAGGGCTCTTCTCTCGGGAAGCAGACGATCCATGTAAGCCGATCGGAGCTGTGGTCCAAG
ATCGGGCACAAGGTGTCGATTGCGCGGCTGGAGAAGCCTCACGACATCCAAAAGACGTACTTGGAGCCGGCGCTC
AAGGAGCTCAAGCGGGATGGCAGCCAAGTCGAACAGGCAGGCGCTGTGTATCATCAATTTGCCACATTCTGCGAC
GAGCAGCTGCAGGACGCCGACGGACTTGAGGATCTGGAGAGGCTGCAAAGCCTGCGGAAAGGGAAGAGTGACGAG
GTGGCTGAGCTCAAGAATCTGGTTTCGTCGACCAAGGAGTCTCAGCTTCGGACCAAGTACGCTCACGTGCTGGCG
AGAGAGAAGCAATGGCTAGAGCTGGACGAGCAGGAGCTGCGACGGGTCGAGCAGACGCGAAGCGAATTCGTACGG
CTCAGCCTGGAGAATTACTTGCTATCGCTCGCAGCGTCAGACGAGCACAACAACGACGCGCTGCGGTTCACGGCT
CTCTGGCTGGAGCGGTCCATGGAAGACGGAACGAACAAGGCGGTGGCTCGTCACCTGGACCAAGTGCCGACGAGG
AAGTTTGTCGGTCTGATGAACCAATTGACCTCGCGATTGCAGAAGCAGGAGTCAGACTTTCAGAAGCTGCTGTTC
AAGCTCGTGCTGAATATCTGCGTCGATCATCCCTACCACGGTATGTACCAGATCTGGTCGGGGACAAAAGCCAAG
GCGCAGCAGAAGGATGAGGTCGCGGTGCTTCGCGTCAAGGCGACGGAAAGGGTGGCTCAGCGGCTGGCCGATAAC
AAGGCTGTGACCAGCGTGTGGCAGTCGGTGGACAAGGCCTGCAAAAGCTATCATGGACTGGCGGTGGAAAAGGGC
AAGGAGTACAAGTCAGGGGCCAAGGTGTCCCTCAAGGAATCCAAGGCTGGACAGGGCCTCGTGGCGTGTCTGGCA
CGGTACAGCATCCCTCCACCTACGATGCATCTGGACGTGTCGGCCAGCAAGGACTACTCGGACGTTCCGCACATG
GTGAGGCTGGAGCCGACGATGACGATCGCGTCGGGCATCAGCGCGCCCAAGATCATCACCGTGGTGGGCAGCAAC
GGCATCAAGTACAGGCAGCTGGTCAAGGGCGGACACGACGATCTGCGGCAGGACGCCATCATGGAGCAGGTCTTT
GCAGCCGTCTCGTCGCTGCTCAAGCTTCACCGCAGCACGCGGCAGAGGAGGCTTGGGATCCGGACGTACAAGGTG
CTGCCCCTGACGACGGCGTCTGGGCTCATCGAGTTCGTGCCCAACACCATCCCCTTGCACGATTTCTTGATGCCG
GCGCACGAGCGGTATCATCCCAAGGACCTCAAGGGGTCGCAGTGCAGGCGAGAGCTCTCGGGGGTTCAGCACCGG
ACAGTTGACGTACGTGTCAACACGTATCGAAAGGTGACGGAAAGATTCCAGCCGGTGATGCGGTATTTCTTCATG
GAGAAGTTCAACGACCCGGACGAATGGTTCAGCCGGCGTCTGGCCTACACGCGGAGCACGGCCGCCATCTCGATG
CTGGGCCACATCCTGGGACTCGGAGACCGACACGGACACAACATCCTGCTCGACACCAAGACGGGCGAGGCGGTG
CATATCGACCTCGGAGTGGCCTTTGAGGCGGGTCGAATCCTGCCGGTGCCGGAGCTGGTACCGTTTCGCCTGACG
CGGGATATTGTCGACGGCATGGGCATCACCAAGACGGAGGGCGTCTTCCGTCGCTGCTGTGAGTTTACGCTGGAT
GCGTTGCGGGAGGAGCAGTATTCTATCATGACGATCCTCGACGTGTTGCGATACGATCCGCTTTACACCTGGTCC
ATCTCGCCCGTGCGGCTGGCCAAGCTGCAAAAGGCCCGGGCCGAGGACGACGGCCCAGAGGCATCGGAGCAACAC
GCGGAGACCGAGGCCAGCAAGGGGAGGGGAGGCAGCCGGTTCAACGAGCCGTCAGAGGCGGACCGGGCGCTCGAG
GTGGTGCGGAAGAAGCTGTCCAAGACGCTGAGCGTCAAGGCGACGGTCAACGATCTCATCAACCAGGCCAGCGAT
GAGAGGAACTTGGCTGTTTTGTTTGCGGGGTGGGCAGCGTACGCCTAG
Gene >Ophun1|3533
ATGGCTGACACGACCCCCCTCCTCCGCCGCCGACCAGCCCTGCACGCAGGTGACAATGACGACATCGAGCGCGAA
TTCGACCACCTGCGCAGCCTCGCCCGCGCCGAAGCCGACAAGCGAAATTCGTGTTTCGACAGGGTACATACGAAT
CCCGACCCATCTCCCCCCCAAAACTCCTACTGAAAGCCAACCCCCCCCTGCGGGGATGACAGTCGCGACAAGCCT
ACAAGTCCGGCGATGGCGCCGCCGCAAAGGCCCTCTCCAACGAGGGTAAGAAGCACGACGCCAAGATGGACGAGT
ACAACCGCCAGGCATCGGAGTACATCTTTCGCGAGAATAACGCGCCCGGTCGCGTCGAGCCGGACGCTATTGACC
TGCACGGCCAGTTCGTCGAGGAGGCTGAGCGCATCCTCGAGCAGCGTATACGTGAAGATCAGGCGCGCGGTCAGA
CTCATCTGCACGCCATTGTCGGAAAGGGCAACCATTCGGCTGGCCATGTGCAGAAGCTCAAGCCAAAGGTCGAGG
AGTTGTGTCGCGAGCTGGGGCTGAGGTATCAGACTGAGGAGAACGCAGGAAGGATATACATCAATCTTCAAGGGG
GTGAACCGGTGCCTCCTCAGCACCATCCGCAACAGCAGCAACCCTCATATCACCAGCCGCACCACCAACAACCTC
ATCATCATCAACCTCAACATCACCAGCAGCAGCAGCAGCAGCACGGGCATGCCAACCAGCAAGACGACGTCGCCC
AAATGGTGGAAAAGGCTCTTCCTCGCATCCTGCGCAAGCTGGAAAAAGCATGCTGTGTTGTCATGTAGCCTCCTG
TGGCATCTTCTTTGGCTGTCTCTTGCTGTTTCTTGGCATTTACTTGGCCATCTCTGGATCATCTTCTGGGACTTT
CTTGGATGTTTCTTAGACGCCTCTTGCATATATACATACATATTCTGGATCTTCTCGAATACCAGTTTCACATGT
CGAAGCACTTCCATCCGAACTTCGGCAGACAGAAGAGTACCTACCGAGTTAGGTCACGTGGATATTTCAAGGGGT
AAGACTGAGTATGACTAATGAGAGCTGCCATGTTGGTGCGAATTTCAAGGCGCCGCGTTGTAAAAATAGCCGACT
CGTGGCACCCACCCTATACCTATACAACGATGAGATGAAAGACGAGTTGCATGGCGTCTCCGCAGACACTGACAG
TGAAGCATCTCGCTCGTGAGCTTAGCCTGCTGCCCAGCTAACCGGCTGTCGAGTGCTGACTCCTCGCAGGCGACA
TCAAGTCCGGCTCTCTTCGAGATCGCGAGCGAGCGCTGGATGACTTGGCTCAGCTTCTGAGGAATAGAGCTGCTA
ACCTGTATGTGCTTGGAAGCGCTCCTTGTGAATAGTCAAGACACTAATTCATGTATCCAGTGCCGCCTTGGAAGA
TAAAGGCTATCACGAAATCTTCGAGGCCATTTTCGGCTTCGTTCTCGGCGAGGTTCGGGTTTACAGAGACAGCAA
GCTTTCAAAGCGCAATGGGGCTGCCTCGCGACTCGCCAAGTGTGCTGCCGCCCTCAGAGTGGCAACGGCTCGAGG
TTCTCCCAAGCTGGGACGCAAGACTCTACTCGCCCTAGTAGATCACATCACGGAGCTTCTGTCGGGCCCGGACGG
CCTCATCGAGCCGCTCGTGGCGGACTACGTCAAAGCTCTGACCGAAGTGCTTCGGCCATCTCACGTTGAATTCTT
CGCCACAAAGAATGCTGTGCCCTGGGGAAAATGCGTCGACTTTCTCATTATAGTCGCAGAGAACAGCCTGCCGTC
CGGGACACTTGGTCGGGACTCGCATTCCATCGCCGCTCCGTTGCGTGACTCTCTCAGAAGCTTGCAATACCTAGT
TCAGGCGGCGAATGCTCCTTCAAGTCGGTCACAGGATGTCATGGACCTTGTGCTTCGAGTATTGGGCCTCAAGCA
GCTCAGTCTTGGCTCCACACAGACGGCCTGCTTCTCCATCATCAACACCATCTTTGCCTCAACGCATGCCGACGA
CCTTGCGTTCGCAAATGATCTCGTCAGGCGTCTCTTGCCCTTGATGGCATACTGGTGGCGTACCGACAGAGTATC
CCAGGACGAGCTCATCAAGGCCTTGAGGAACGAAATCTCAAAGACGGTGATTTTGACTCATCTACATGTGGAGCA
CCTAGCCGTCGTCAATTGGGACTCTGGCGTGCGCGATCTTGTCCAAGACTTGCTAGAGCCCCTGTGGCTTGAATA
CTCCAGACGAAACGAGGCATTCCAGCTGCAACTCGACGACCTCACGTTCTGTCCGGACTCGTTACATGTATCCAA
CGGCTCCATGCGGCTCGACCTTTTTGGACTTCGTCACCACAATATCGAGGGTGAAGGTCCCTGGGCTCTGGTCCA
GAATTTGGCTCTATTAGAAGCAATCCTCTTGCGACCAAGGAAGAGTCAAGCCAAATGGGCCAACGAACCAAGCTC
CAAGAAACGGCGACTGACGGACAGCTCAAGCCGTCTGAGACTGAAGCTCAAGTCGAGAGACGTCGGTCTGCAGCG
AACCGCTCTTCAACTAATCCCCTTTTTAATCGCCACCTGTGCTCTGGAGAAGGCAGATGCAGTGGAACTGTTCAC
TGAGCTCGTGTCTTATGTCACAGATAAGAATACTGTGACTGTGTCTTGGGCATTGATCGCCTGCGCAAGGTATCT
ACATGTTCGTCTCGTCATACGCGTTCTTCTGTCGCTAACAATAGCCAGTTGCGCTGCGTTGCCGGATCTGCGCAA
GGATCATGGCGATGAATGGAGACAGCTTTGGCACGTGGCGGCCAGATCTCTCAGTCTTCCAGCGACCAGTCGTGC
GTCCTGTGTTCTACTGCTTGCCATCTTGCAGACAGGTCTTGTGCCATATCACTCTCTCGCTGAGGACATCAACGG
CTTTGTCGTCACAGCTGATGTGAACGGGCCCGCGATTCTTTGCGACGCGTCCTTGTCACTAATGTCTCGTCTATT
TCACGAGCGCAACGCCAGGCTTCCGAGCGCCAGCCAAGCCACGAGCAGCCACGTTATAAGATGGGTTTTCATGAG
ATGGAACCCGAGTGAGCTTTCAATGCGCCTCCGACACCTCTCAGGGGCTAACAGAGTGACGATAGACGAGTCAGG
CTACTCCTCCTTGCAGTCGCTTCACGTCTCGCCGTTACAGTTTGTCAATCTTCTGCGAGCGTGCTGTGGCGCGCA
ACCCGTGGCTTGGAGCGGCCAGCCCGCGATCTCTGGTTCGACCCTTGGCGAAGCATGGAGGCTGCATGAAGAGAT
TGCCCCCTTCATCCGATATCTTTTACTTCTTGAGCGCAAAGAGGTTGTATTGCCGTCCGAGGACAGCGGTTGCTT
ATCAACGGAAAGCCAGAACTCGCAACCAACGAACTTGGGGAACTCCTACTCGTCGATGAAACTGACTTTGGAGCT
GTTGTGTCCGAAGCTGGAAGACCTGCGCTCCTTGTGCGAGTCTTGGAACGACCAGACAACTCGGGCCGGCAAACG
ATGCTCTCTCGAAGGATTCCAGAGTCTGTTGTCGGCGTGTCTCATCAGCGCCTTGCTTTTGCCGCAATTCAGACA
GTTGAACTCTGCACAGTCGTCCAAAGTCGAAGCAGAATTGGTTGAAATCGTCGAACAAGGCCTGGCATCCGCCCT
AAGTTCAGCCGAGCCCGTGGCAGCAATTCATCTGGCCTTGCGACTCTTGCGATGCTGTATGCCGGACCTCACTAC
GGACAACCTCAATCATGTTCACCGAGATCATTCCGGCCTCCTCCGCATCATGGCCATTGTTGCTAGCTCACTGGA
TAGGACAGAGCTGGGATTTGGCTCTCAGGATTCAGACTTGATGGGAATTGACGATGAACTCGACGACACCCAAGT
CAGCAAGGCCACGACCTTGTCAAACTCCGCTCCCTTGCCGAGGCAAGTCCAGCAACTGTCCATTAACCCCCGAGC
ATTCTACATCGAGACAAAGGCCCGTCTGGCTCTGTTCCAGACAGTTCATACGGACAGCAGCCAGGTCGGCCTGGT
TCCCAAAGCCTGGCTCGATAGCACCCTGTCCATGTCGGACGACGATGTGCTGTCGTGTCGCGGCCTGTTGATTGA
ACTCTCGACATGCGACCTCACCATGAATTCAGACAACGCGTTGGACTTGGTTCAGCGACTGGGCTCCATCATGAG
TAAATCCGAATATCAGTCCTGCGAGGTTGCGCTCACCGCCTGCATCGAGGTCCTCAACGGCCTCCATCAGCTGTG
GCTTGGGGATACCCAGGATCTCGCGGAGAGTGCGGGCGACTTCTATCACTACTTCATCAAAGTCGCCCTGCCGTC
GGGCGTTTTTACTCCCAGGGCGCAGATATCCATGGCCCGTCTGCTCTTTACGCTCCTCCGCGTCGATCCAGACTA
CGGCACGAAACTCGGGCTCAACTCATGTCGGACGTCACTGTTATACATTCTCAGCAGCGGGACTATGAAGGTGAA
ATACTTCATTGGCGATAAGATCGCCGGCATCTTCGAGCTGTTTATTCTGCAACTGCACGACGACGTCTTCGTCGA
CGTACTGGAGAACCTGCCAACGGATGCTGAAGACACTGCCGGTATCGCGTTCCGGCTGCTCGTTCTTTCAAGGCT
GGCATGCCGGTGGCCAACTTTGCTGCGAAGATGTATATATCACATCTTTGAGACGCCTGGCAAGATACCCGAAGC
GACCGACTATGCCACCTGGTGTCTGGCGGACGTTGCTCGTGAATTGGACCTTGCTTCGCCGAAGAAGCTGTTCGA
ACTCTTCTCGCGCCAGCTCCTGTACACATGGATGGAGAACGACGCATTGGCAGACATACCGTTCAGCATCTTTGG
GTTCGACGATCTGGAAAGCCTGCTGACTATGGCTCAAGCTGAGGCGGTTGCGCTGGCCATGATGCGAGGCCAAGA
GGTTGTGAGCCAAGACCTGGCTCGGTTCATCGGGTCGAGCGAGAAAGAGCTGCTGCAGCGCAATTTCACGACAAC
AATCTCGTACTGCATGATGTACGCCGATGTTTCTGGCGGACCCGGCCCCATGGAAAGACTCGAGACGGTTCTGGG
GAGCCAGGCCTACATGGCGGCCATCTATACCAACTTCGTGGACATTGTCGCCCTTTGTTTCAATGTTGTCGACCA
GGACAGCTCGCCTGAGAAAGTGTTTCGTAGATACACTGATCTCGTCTACGCTGCTGATAACCTGAAAGCCATCAG
GGACATGGCTCACTCGCCCGCAGGGCTACCCCCGAACCAGCAGCCAACATTCAGGACCAAGTTTGTGATTCACAA
CCTGCTAAAGCTTTGTCGAAGAACCGAGTTCGAGTTCCACAAGCTCTGGACACCGGCTCTGGCCATGTCGGTCAT
CAGACAGCTCTTCAACACCGTCCATCCAGCGCTGGGCTCCCTACACGCCTGCTCTGTTCTCAGAAAGGTCCGGCT
TGTGCTATGTCTGGCGGGGCCTGTGGCATTGAACACATTCTGTCTTGAGATGCTTCTGAACTCGATGCGCGGCTT
CATGGTCGACTCGGAATGCGCCGACGATGCCCTTGGCATGACCCAATATCTTCTTGTTGGAGGATCCCGGTACTT
GAGACAGGTGCCTTCGTTCCTGGCTGGCTATGCCCTTTCCACCTTGACCTCCCTCCGCGTCTTTCTCGAATCGAG
CCAGGCGAGCACAACTCAGGAAAGCCAGTTCAAGGCGACAATGGACAAGGCACAAAGATTTCACGAGTTTTTCGG
AAACTACCTGGCCAACTACACCTCGTCAGCGTTCCGGAGCGAGGTTCACACTGCCGCCTTCAAGTCTATCACGCA
ATCCGCAGGTCTCATCAGATCATCCGGGAACGCAGAGAAGAGCATGCCGGAAAGCAAGCTGCTGCTGGAAATCTT
GCAGGATGGCGCCTCAGGGCAGGGACTGTTGGACGAGTCGTCTCGTGAGCTCGCTTTGAGATTGCTCTGTGGGGA
CTTCACGTTACCCGCGGCTATTGCGGACGACATCGTGGAGAGCGACGAAGAAGCAGTTTCCTACGCCGGCGCCGT
GTGGAGAAGCTGTGAAGCCCAGAAGCTCAGCCCCAGCTACCTGGCCTGGGCCGGCCGAGTTGTTGGACGATCCTT
TTCAGCTTCGGGCTACATCCCGGACGGAATATTGCGCGAGTCTCGGCTTCGTCAATATGAGGAGATGGTTCCTGG
AGGACCGAACAGATCGGAAACGGGCCTGCTCTGTCTCCTTCAGCGTCTTGCTTCGAGCCAGGATCCGGTCGTAGC
AGGCCTATCCGAGGTTACCCTGAGGACGGTCGTCTCCCAGGCCGTCTTGAAAGAGGATGCAGAGCTTCTAGCCGC
CTGTCAGAAGACCTTGACGGAAGCCTTGTTCCTTGCCTCCCAATGGGGGGCTTATCGGTCTCCCCCCTCGGAAGC
GCTGGAGACTCCCGTCTTTTCAGATGCGTGGACAGAAGACATCAGATCCGACCAATGGCTTTCGAAGCTCAGTGT
TTGTTTGGCAAAATCTGTGCCGGGCTCGATTCTTCTCTCTGCCCTCCCATCGGGCCTGGGAAGGCTGAGAGATAT
GGCCGAGAAATCGCTCCCCTTTGTGGTTCACCTAGTCCTTTCTTTCCAGATGAAGCAGCCGGCCACTAAGCGTCA
ACTGTCGGCGGCGATCAAGGAGTGGCTTGGCTGCAAGGAACCCTCCGCGAGGAGCAACCTGAAGCTCCTGATCGA
CACGATTCTCTATCTGAGGACCCAGGAATACCCAAAGGAGTCATCGATTGACGATCGATCACATTGGCTGGATAT
CGACTACCCCATCGCAGCGGCAGCGGCTTCGCGATGCGGCATGTACAAGACTGCTCTCCTGTTTGCCGAGCTTGC
CGCCTCCTCAGACAGCACACGCGCGTCCCGCAGGTCGTCTCAGGCACGAGATTTGGACATGAACGACACTCTCCT
CACCATCTTTGAGAATATCGACGATCCTGACATTTACTACGGCCTCGCCCAAGACGCGAGTCTCGCCAACGTCAT
CGCTCGTTTAGAGCACGAGAAGGAGGGTCACAAGTGTCTCGCGTTTCGAGGAGCGCAATTCGACAGTCACCTTCG
ATTTCAGAGCCAGGAAGCAGAGCCAGACGTTCGGGCCTTGGTAGGGACCCTCGGCACAATTGGTCTGTCGGGACT
CTCCCACTCGCTGCTCCAGACGCAGCAGGATATCGGCTCATCAGGCTCGGTGACGGAGACGACTTATCGATCAGC
GAGGCGACTGGAGATGTGGGATCTTCCTGCGCCGTCTTCCTCCGAGAACCACAGCGTTGTCGTTTACAAGGCATA
CCAAAGCATACAGCAGGCGGTGGATCTACCGAAAGCCCGATCGGCGGTCTATGACGGCATCAGTCACATCATGAG
AGGCCTGACTGGGGCCAGTCTCAACGCAACGGGGCTGAGGAGCCGCTTGGCTTCACTGGCGTCGCTCACGGAGCT
GGACGATATCCTCAACGCTGCGGATACGACCGGGATTGACAAGGTGCTGCAAAAGTTCCACGGCCGGTGTCAATG
GATGAGAAGCGGACTGTAAGTCGATGGGTGAGGCGGGCGAGACGGTCATTGCTAACAGCCGCCAGCTACGACGAC
GTGAGTCAAATCTTGTCGTGTCGAGAGACGACGACAAGCATGTTGAGCCAACACGAGGACCTCATGGGCAGCGTC
AAGCTCCCCGTCGCCTCGCTGAGGCGGCTGCAAGTAGAAACGATGCTGCTGGCGTCTGACATCTACCGCTACCAT
CAGGCGACGCAGGAGTCGCTCAATATCTCGACTGCGCTCAACATGCTAGTGCCCGTGTGCGAGAAGCTCGGCCTC
AATGTCGATGCAGCGGTCAAGATGGAAGTGGCCAGCTCGCTGTGGGAGCACGGGGAGATGAGCAGCAGCATCCGG
ATGCTTCAGGCCATCGACAAGGGCTCTTCTCTCGGGAAGCAGACGATCCATGTAAGCCGATCGGAGCTGTGGTCC
AAGATCGGGCACAAGGTGTCGATTGCGCGGCTGGAGAAGCCTCACGACATCCAAAAGACGTACTTGGAGCCGGCG
CTCAAGGAGCTCAAGCGGGATGGCAGCCAAGTCGAACAGGCAGGCGCTGTGTATCATCAATTTGCCACATTCTGC
GACGAGCAGCTGCAGGACGCCGACGGACTTGAGGATCTGGAGAGGCTGCAAAGCCTGCGGAAAGGGAAGAGTGAC
GAGGTGGCTGAGCTCAAGAATCTGGTTTCGTCGACCAAGGAGTCTCAGCTTCGGACCAAGTACGCTCACGTGCTG
GCGAGAGAGAAGCAATGGCTAGAGCTGGACGAGCAGGAGCTGCGACGGGTCGAGCAGACGCGAAGCGAATTCGTA
CGGCTCAGCCTGGAGAATTACTTGCTATCGCTCGCAGCGTCAGACGAGCACAACAACGACGCGCTGCGGTTCACG
GCTCTCTGGCTGGAGCGGTCCATGGAAGACGGAACGAACAAGGCGGTGGCTCGTCACCTGGACCAAGTGCCGACG
AGGAAGTTTGTCGGTCTGATGAACCAATTGACCTCGCGATTGCAGAAGCAGGAGTCAGACTTTCAGAAGCTGCTG
TTCAAGCTCGTGCTGAATATCTGCGTCGATCATCCCTACCACGGTATGTACCAGATCTGGTCGGGGACAAAAGCC
AAGGCGCAGCAGAAGGATGAGGTCGCGGTGCTTCGCGTCAAGGCGACGGAAAGGGTGGCTCAGCGGCTGGCCGAT
AACAAGGCTGTGACCAGCGTGTGGCAGTCGGTGGACAAGGCCTGCAAAAGCTATCATGGACTGGCGGTGGAAAAG
GGCAAGGAGTACAAGTCAGGGGCCAAGGTGTCCCTCAAGGAATCCAAGGCTGGACAGGGCCTCGTGGCGTGTCTG
GCACGGTACAGCATCCCTCCACCTACGATGCATCTGGACGTGTCGGCCAGCAAGGACTACTCGGACGTTCCGCAC
ATGGTGAGGCTGGAGCCGACGATGACGATCGCGTCGGGCATCAGCGCGCCCAAGATCATCACCGTGGTGGGCAGC
AACGGCATCAAGTACAGGCAGCTGGTCAAGGGCGGACACGACGATCTGCGGCAGGACGCCATCATGGAGCAGGTC
TTTGCAGCCGTCTCGTCGCTGCTCAAGCTTCACCGCAGCACGCGGCAGAGGAGGCTTGGGATCCGGACGTACAAG
GTGCTGCCCCTGACGACGGCGTCTGGGCTCATCGAGTTCGTGCCCAACACCATCCCCTTGCACGATTTCTTGATG
CCGGCGCACGAGCGGTATCATCCCAAGGACCTCAAGGGGTCGCAGTGCAGGCGAGAGCTCTCGGGGGTTCAGCAC
CGGACAGTTGACGTACGTGTCAACACGTATCGAAAGGTGACGGAAAGATTCCAGCCGGTGATGCGGTATTTCTTC
ATGGAGAAGTTCAACGACCCGGACGAATGGTTCAGCCGGCGTCTGGCCTACACGCGGAGCACGGCCGCCATCTCG
ATGCTGGGCCACATCCTGGGACTCGGAGACCGACACGGACACAACATCCTGCTCGACACCAAGACGGGCGAGGCG
GTGCATATCGACCTCGGAGTGGCCTTTGAGGCGGGTCGAATCCTGCCGGTGCCGGAGCTGGTACCGTTTCGCCTG
ACGCGGGATATTGTCGACGGCATGGGCATCACCAAGACGGAGGGCGTCTTCCGTCGCTGCTGTGAGTTTACGCTG
GATGCGTTGCGGGAGGAGCAGTATTCTATCATGACGATCCTCGACGTGTTGCGATACGATCCGCTTTACACCTGG
TCCATCTCGCCCGTGCGGCTGGCCAAGCTGCAAAAGGCCCGGGCCGAGGACGACGGCCCAGAGGCATCGGAGCAA
CACGCGGAGACCGAGGCCAGCAAGGGGAGGGGAGGCAGCCGGTTCAACGAGCCGTCAGAGGCGGACCGGGCGCTC
GAGGTGGTGCGGAAGAAGCTGTCCAAGACGCTGAGCGTCAAGGCGACGGTCAACGATCTCATCAACCAGGCCAGC
GATGAGAGGAACTTGGCTGTTTTGTTTGCGGGTGAGTTTGGTGTGTGATGGTGGGTGGTTGGCTTGACTGACGTG
GATTACAGGGTGGGCAGCGTACGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail