Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3532
Gene name
LocationContig_313:8128..16007
Strand+
Gene length (bp)7879
Transcript length (bp)6765
Coding sequence length (bp)6765
Protein length (aa) 2255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 4.3E-70 1898 2222
PF13637 Ank_4 Ankyrin repeats (many copies) 2.0E-05 1559 1604
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-08 1626 1677
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.8E-14 1558 1654
PF03105 SPX SPX domain 3.5E-09 1099 1136
PF13606 Ank_3 Ankyrin repeat 4.1E-03 1626 1652
PF00023 Ank Ankyrin repeat 1.9E-02 1626 1654

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 1099 2232 0.0E+00
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1823 2229 2.0E-132
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 1785 2236 2.0E-96
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1099 1821 3.0E-81
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 1099 1977 5.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 1099 2232 0.0E+00
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1823 2229 2.0E-132
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 1785 2236 2.0E-96
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1099 1821 3.0E-81
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 1099 1977 5.0E-42
sp|Q10003|GPCP2_CAEEL Putative glycerophosphocholine phosphodiesterase GPCPD1 homolog 2 OS=Caenorhabditis elegans GN=T05H10.7 PE=3 SV=1 1819 2221 8.0E-42
sp|Q21407|GPCP1_CAEEL Putative glycerophosphocholine phosphodiesterase GPCPD1 homolog 1 OS=Caenorhabditis elegans GN=K10B3.6 PE=3 SV=2 1795 2221 4.0E-38
sp|Q80VJ4|GPCP1_RAT Glycerophosphocholine phosphodiesterase GPCPD1 OS=Rattus norvegicus GN=Gpcpd1 PE=2 SV=1 1846 2221 5.0E-38
sp|Q8C0L9|GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus GN=Gpcpd1 PE=1 SV=1 1846 2221 2.0E-37
sp|Q9NPB8|GPCP1_HUMAN Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens GN=GPCPD1 PE=1 SV=2 1846 2221 8.0E-36
sp|Q680A6|GDPD3_ARATH Glycerophosphodiester phosphodiesterase GDPD3 OS=Arabidopsis thaliana GN=GDPD3 PE=2 SV=1 1894 2236 1.0E-34
sp|Q9SGA2|GDPD1_ARATH Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic OS=Arabidopsis thaliana GN=GDPD1 PE=1 SV=1 1894 2244 9.0E-32
sp|Q9FLM1|GDPD2_ARATH Glycerophosphodiester phosphodiesterase GDPD2 OS=Arabidopsis thaliana GN=GDPD2 PE=2 SV=1 1889 2229 3.0E-31
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 1433 1677 7.0E-18
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1460 1677 1.0E-15
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1290 1677 8.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1434 1677 2.0E-13
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1441 1666 3.0E-13
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 1427 1677 4.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 1439 1682 5.0E-13
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1434 1677 5.0E-13
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 1426 1677 6.0E-13
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1461 1689 7.0E-13
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 1426 1677 8.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 1449 1682 1.0E-12
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1461 1689 1.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1449 1680 1.0E-12
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 2054 2193 2.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1461 1689 2.0E-12
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1449 1680 2.0E-12
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1463 1697 3.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1463 1697 3.0E-12
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 1099 1276 3.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1467 1677 5.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1466 1646 9.0E-12
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1365 1677 9.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1534 1677 1.0E-11
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1437 1680 1.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1534 1677 1.0E-11
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 1455 1677 1.0E-11
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 1466 1677 2.0E-11
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 1467 1677 2.0E-11
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 1442 1678 2.0E-11
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 1454 1723 3.0E-11
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1464 1649 3.0E-11
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 1442 1722 3.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1454 1677 8.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1451 1697 9.0E-11
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 1467 1677 9.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1460 1677 1.0E-10
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1467 1677 1.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1466 1646 1.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1460 1696 1.0E-10
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 1570 1702 1.0E-10
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 1467 1677 1.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1439 1684 2.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1460 1707 2.0E-10
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1460 1677 2.0E-10
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 1466 1730 2.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1454 1677 3.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1470 1680 3.0E-10
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1434 1666 3.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1467 1677 4.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1467 1677 4.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1454 1677 4.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1439 1684 4.0E-10
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1434 1666 4.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1467 1677 5.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1436 1669 5.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 1348 1694 6.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1470 1677 7.0E-10
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 1461 1677 7.0E-10
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 1509 1678 8.0E-10
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1454 1677 8.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1460 1677 8.0E-10
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 1467 1677 9.0E-10
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1439 1684 1.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1447 1677 1.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1447 1677 1.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1467 1677 1.0E-09
sp|Q63369|NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 1423 1677 1.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 1464 1677 1.0E-09
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 1464 1677 1.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1460 1677 2.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1463 1677 2.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 1464 1677 2.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1376 1677 2.0E-09
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 1454 1669 2.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1498 1677 2.0E-09
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 1507 1677 2.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1359 1677 3.0E-09
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 1439 1970 3.0E-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1460 1677 3.0E-09
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 1570 1702 3.0E-09
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 1507 1677 3.0E-09
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 1515 1689 4.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1467 1677 4.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 1464 1677 4.0E-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1451 1677 4.0E-09
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1458 1677 4.0E-09
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 1507 1677 4.0E-09
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 1464 1677 4.0E-09
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1099 1250 4.0E-09
sp|P19838|NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 1508 1677 4.0E-09
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 1507 1677 4.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1451 1677 4.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 1464 1677 5.0E-09
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 1434 1677 5.0E-09
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1463 1684 6.0E-09
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 1554 1689 6.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1471 1680 6.0E-09
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 1464 1677 6.0E-09
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 1434 1677 6.0E-09
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 1446 1677 6.0E-09
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 1498 1673 6.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1427 1677 7.0E-09
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 1458 1690 7.0E-09
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 1498 1673 7.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1437 1677 8.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1458 1677 9.0E-09
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 1570 1702 1.0E-08
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 1552 1694 1.0E-08
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1458 1677 1.0E-08
sp|P25799|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 1417 1677 1.0E-08
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 1509 1680 1.0E-08
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 1446 1677 1.0E-08
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 1498 1677 1.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 1439 1649 1.0E-08
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 1446 1677 1.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 1464 1677 1.0E-08
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 1507 1677 1.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1451 1684 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1435 1677 2.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 1558 1678 2.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1567 1687 2.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1419 1677 2.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1460 1684 2.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1447 1660 2.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1447 1660 2.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 1464 1677 2.0E-08
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 1439 1649 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1467 1677 3.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1435 1688 3.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1460 1684 3.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1438 1677 3.0E-08
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 1464 1677 3.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1447 1660 3.0E-08
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1447 1660 3.0E-08
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 1464 1677 3.0E-08
sp|Q6F3J0|NFKB1_CANLF Nuclear factor NF-kappa-B p105 subunit OS=Canis lupus familiaris GN=NFKB1 PE=2 SV=2 1508 1677 3.0E-08
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 1538 1680 3.0E-08
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 1538 1680 3.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1417 1677 4.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1451 1712 4.0E-08
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 1512 1681 4.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 1460 1677 4.0E-08
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 1584 1680 5.0E-08
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 1558 1698 5.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1438 1677 5.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 1464 1677 5.0E-08
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 1508 1684 5.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 1508 1703 5.0E-08
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 1572 1680 5.0E-08
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 1498 1711 5.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1451 1677 6.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 1512 1680 6.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1470 1691 7.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1451 1677 7.0E-08
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 1467 1677 7.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1467 1691 8.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1439 1684 8.0E-08
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 1512 1718 8.0E-08
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 1509 1680 8.0E-08
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 1454 1661 8.0E-08
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 1454 1719 8.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 1512 1680 9.0E-08
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 1471 1661 9.0E-08
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 1467 1677 9.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1454 1669 1.0E-07
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 1553 1678 1.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1460 1669 1.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1557 1694 1.0E-07
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 1460 1677 1.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1454 1665 1.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1454 1665 1.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 1509 1723 1.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 1451 1677 1.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 1498 1677 1.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1459 1680 1.0E-07
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 1446 1665 1.0E-07
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 1572 1718 1.0E-07
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 1570 1680 1.0E-07
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 1512 1680 1.0E-07
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 1457 1655 1.0E-07
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 1458 1690 1.0E-07
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 1469 1681 1.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1460 1669 2.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1460 1677 2.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1467 1691 2.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1439 1684 2.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1460 1669 2.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1460 1677 2.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1506 1680 2.0E-07
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 1454 1719 2.0E-07
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 1471 1661 2.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 1583 1677 2.0E-07
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 1459 1677 2.0E-07
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 1512 1680 2.0E-07
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 1458 1663 2.0E-07
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 1569 1750 2.0E-07
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 1427 1699 2.0E-07
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 1512 1722 2.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 1561 1682 2.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1463 1697 3.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1460 1677 3.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1467 1680 3.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1451 1697 3.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1451 1677 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1506 1680 3.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 1564 1677 3.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 1583 1689 3.0E-07
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 1558 1673 3.0E-07
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 1572 1722 3.0E-07
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 1558 1677 3.0E-07
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 1427 1677 3.0E-07
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 1554 1713 3.0E-07
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 1512 1680 3.0E-07
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 1512 1680 3.0E-07
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 1500 1677 3.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1561 1683 4.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1415 1677 4.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1558 1677 4.0E-07
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1454 1677 4.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 1454 1728 4.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 1449 1652 4.0E-07
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 1512 1680 4.0E-07
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 1555 1680 4.0E-07
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 1420 1652 4.0E-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 1512 1680 4.0E-07
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 1511 1677 4.0E-07
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 1515 1662 4.0E-07
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 1569 1685 4.0E-07
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 1569 1685 4.0E-07
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 1569 1685 4.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1509 1660 5.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1461 1677 5.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 1448 1696 5.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 1561 1680 5.0E-07
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 1460 1677 5.0E-07
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 1558 1677 5.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 1512 1680 5.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1460 1666 6.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1460 1666 6.0E-07
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 1452 1648 6.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1558 1677 6.0E-07
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 1454 1677 6.0E-07
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 1558 1705 6.0E-07
sp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g0573000 OS=Oryza sativa subsp. japonica GN=Os04g0573000 PE=2 SV=2 1099 1289 6.0E-07
sp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_17046 OS=Oryza sativa subsp. indica GN=OsI_17046 PE=3 SV=1 1099 1289 6.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 1467 1704 6.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 1512 1680 6.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 1569 1750 6.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1438 1677 7.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1460 1677 7.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 1468 1677 7.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 1556 1677 7.0E-07
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 1556 1677 7.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 1512 1680 7.0E-07
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 1561 1677 7.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 1507 1677 7.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 1556 1690 8.0E-07
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 1462 1684 8.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 1572 1680 8.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 1468 1677 8.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1574 1677 9.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1454 1677 9.0E-07
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 1452 1648 9.0E-07
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 1512 1689 9.0E-07
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 1512 1680 9.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1574 1677 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1574 1677 1.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1454 1677 1.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 1452 1648 1.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1458 1677 1.0E-06
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 1451 1645 1.0E-06
sp|Q6EPQ3|SPXM1_ORYSJ SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1 1099 1273 1.0E-06
sp|A2X8A7|SPXM1_ORYSI SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2 1099 1273 1.0E-06
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 1500 1677 1.0E-06
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 1467 1677 1.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 1460 1677 1.0E-06
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 1441 1689 1.0E-06
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 1462 1684 1.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 1459 1677 1.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 1556 1690 1.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1561 1683 2.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1297 1677 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1467 1694 2.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1434 1677 2.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1434 1677 2.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1558 1677 2.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1558 1677 2.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1451 1665 2.0E-06
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 1460 1814 2.0E-06
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 1439 1706 2.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 1565 1680 2.0E-06
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 1460 1677 2.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 1558 1677 2.0E-06
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1099 1324 2.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 1508 1703 2.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 1564 1677 2.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 1432 1709 2.0E-06
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 1512 1722 2.0E-06
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 1583 1689 2.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 1572 1680 2.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 1460 1677 2.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 1574 1677 2.0E-06
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 1508 1677 2.0E-06
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 1558 1677 2.0E-06
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 1460 1660 2.0E-06
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 1515 1677 2.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1509 1679 3.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 1558 1694 3.0E-06
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 1460 1652 3.0E-06
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 1515 1677 3.0E-06
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 1515 1677 3.0E-06
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 1569 1677 3.0E-06
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 1569 1677 3.0E-06
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 1569 1677 3.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 1512 1680 3.0E-06
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 1460 1652 3.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 1556 1700 3.0E-06
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 1569 1677 3.0E-06
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 1567 1681 3.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 1454 1677 3.0E-06
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 1567 1681 3.0E-06
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 1567 1681 3.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 1498 1677 3.0E-06
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 1567 1681 3.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 1565 1680 3.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1454 1680 4.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 1459 1647 4.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 1459 1647 4.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1445 1677 4.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1463 1697 4.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1392 1680 4.0E-06
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 1558 1677 4.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 1512 1690 4.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 1512 1690 4.0E-06
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 1515 1677 4.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 1512 1690 4.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 1558 1677 4.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 1463 1665 4.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1470 1677 5.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 1460 1728 5.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 1560 1694 5.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 1562 1680 5.0E-06
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 1570 1652 5.0E-06
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 1556 1660 5.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1460 1677 6.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 1460 1677 6.0E-06
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 1467 1706 6.0E-06
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 1463 1652 6.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 1561 1677 6.0E-06
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 1463 1652 6.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1467 1694 7.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1464 1677 7.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1463 1697 7.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 1557 1683 7.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 1561 1677 7.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 1561 1677 7.0E-06
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 1569 1677 7.0E-06
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 1456 1675 7.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 1449 1652 7.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1574 1677 9.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1463 1680 9.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1460 1680 9.0E-06
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 1440 1650 9.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 1512 1680 9.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1574 1677 1.0E-05
sp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g0129400 OS=Oryza sativa subsp. japonica GN=Os06g0129400 PE=2 SV=1 1099 1231 1.0E-05
sp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_21475 OS=Oryza sativa subsp. indica GN=OsI_21475 PE=3 SV=1 1099 1231 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0006629 lipid metabolic process Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 1077 1099 22
2 1466 1488 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3532
MQLFAMGRGRTIVMSAAVADASRKGRRLMELDQQLDAARQALVALQSADPTPKEPEPPSLDAAMPEISLDQMKYL
WVSLKEVWFARPYMKELHMPATASTSKLVLSLKERLYGSPSEKSMQDTRKTDYKKYHKEALAEESDPSIITREAQ
KDSHLYHESRAVEQVVLQLLSRAAKIQTCTRRGRNPSFDEARDLVSRSAMQYTYPIIDRERWRRNQILLNKCLRE
VIALRTIPLREKIGRVCYNLLVSTYAPDIHHYNTLIVAFDEAGLHAFSEAIIWSFFHGRLLRPTPLTYVAILNHC
KVVGNHGRFLMVLARIAGCDSAIGGKIARRHIEDCVSDGELNAWASDTDLRTQIGEWVFEHVPLNRAIVSEIIIG
LLRFHMFHHAVHFFFACVQCEVFLSAAVVKSLLDECVAALDWRGAFELIYGLLVHDRSWKAFMLTGDVAADWYLI
NRIYTLLDICGLRYGPQWTSREYLDALGIPPERLAGLLFDLELHEQWLHRPCFPESVKGKPDMAIGAQSKLLQLE
SIYKEYVYVRKTTRSIESKLLYPDFPLEWRVSMAHHIGDAALQQASQLVKDVEDMLSSIVGFGPWLYPVDSDRRM
EARKRYLRRAREEAGDEAETRLEGDATESSRTEASTAQGNLVSTQCPREAAERKQQEALVSQLRALRHEVDEPHV
ETVPLQSPGRSALEEEMISQIRALRRGGEEPPPKTATLPHEVHENTASLVGKSESLAQSAGTKRESTEQPPKGMP
LALVVREQHGVMVPLPEGSRFLDIIRTRYGRPDTSDEGVLQHVQKRRDSAAPNMRRTETIQKSRCDRSNLGRVMR
DVGRSDARTPLRSRDNEVTTRQPVARWNKAAQPPLQDAQLATRESQETWQQTRKSVATIPVSQRGTEMNTEQLIA
LWSPTAYASSKTKSRADGDAAAAGKDSPAKLKSRKRNPVRKGLRLLRKAGRELTMELPLEALAPRPVEPTVEDDL
DEAARVAEDAKDYTNFEARDFDRWASRITSRTRRARTRFRTSPPASNVFVLFSSLDNDDDDDDDPWDDDEGKRKV
LNSATVPHGWSLGTVIRTNVGSRNSPVAVVFVFVFVFVVVVVFVVSAGMKFGRSLPRNQVPQWAAFYINYKGLKK
LVKAASQRAQEGGAVDPAELFFALDRNLEDVDSFYNKKFAEACRRLNILHNRYGRVPDVVATLDQDEVEEVMAAL
LELRTQLRNLQWFGEINRRGFVKITKKLDKKVPAMSSQHRYISTKVDPKPFAKDGTIARLLAEINRWLSVLGDAD
NVDDSTSDRSTRSLGRASAKAMLLLPQAQLDALDQAVRNDDVVALKSGVDEASLLSGLDAQGQSQGQGLLLNLLQ
RSISARSRDCMAHLLACIKDLDEPDDINGRNCIHRFVIHIGRTKSAALPTNGGEPYPQFIQGHIQPAVSSTVPVK
TINTKEEDHLGEDDEAVQTLLFLLGQLSVQQRQALNRRDSLGRLPLHYAAQFGFVVVCQIIMGKMQEWNQFDVKD
GIDAPEWQDKDGYAPLHLSVIGGHPLTTQALLQGENWQGSSEAKEELRKSVPKSGAVLALAVKSDYEPIVEMLVK
AGVDINWTDKTGESVLHIAARHGHVGCARIILEGSGSQRADLETTENAYSWTPLHVAAVDGSVAVARLLIEAGAD
VSRPDASGWTAKEHAALRGHMDIARMLAVHTNEDEAVSRVAARLQAPENSSIDERRSNGGPRPAEPVKSFGHRYL
TNESLVLVSLGSMDIRKSTDVVNLECVPLTEAHNTQLDTALSVVVSANGAQGEPTIIDLPVHEGISTEPVVFTTR
DATKVKLLFDIVPTYSGSEKNKIGRAVALLSSIKPTLGTQRVNLQGDVCVPIMSSNLDVMGTVNFNFLVITPFHH
VNMEVTSRQTYWKKLSSTMVIGHRGLGKNLTSNKSLQLGENTLPSFIAAANLGAQYVEFDVQLTKDHVPVIYHDF
LVSETGIDAPVHTLTLEQFLHINSDKRRADGGAPLQGGSGRDAPRERSPRPRSNSLAPQRSLSMGYAGVGHEEME
ERMRHTRDFKEKGYKANSRGNFIQAPFATLEDLFRKLPEDIGFNIELKYPMLHESEEHEMDTYAVELNSFCDTVL
AKVYDLAGERHIIFSSFNPDVCLCLSFKQPSIPILFLTDAGCSSVGDIRASSLQEAVRFASRWNLLGIVSAAEPL
INSPRLVRVVKELGLVCVSYGVLNNDPTLVQRQVKEGIDAVIVDSVLAIRKGLTSNDTSTEQSTGTTPEATENTE
NNKT*
Coding >Ophun1|3532
ATGCAGCTCTTCGCAATGGGGCGAGGCCGCACAATCGTCATGTCGGCCGCCGTCGCGGACGCTTCTCGGAAAGGG
CGTCGTCTCATGGAGCTCGACCAGCAGCTGGACGCTGCCCGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATCCG
ACCCCAAAGGAACCCGAGCCGCCGTCTCTCGATGCCGCGATGCCCGAAATCTCTCTCGATCAGATGAAATATCTA
TGGGTCTCTCTCAAAGAGGTGTGGTTCGCTCGACCGTACATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACC
TCGAAGCTCGTGCTGAGTCTCAAAGAGCGCCTCTATGGGAGTCCTTCGGAAAAGAGCATGCAAGATACACGAAAG
ACCGACTACAAGAAATACCATAAAGAAGCTCTGGCCGAGGAATCTGATCCCTCCATCATCACCCGCGAGGCTCAG
AAGGACTCGCATTTGTATCACGAGTCGCGAGCCGTGGAGCAAGTCGTCTTGCAGCTGCTTTCTCGCGCCGCCAAG
ATCCAAACCTGCACCCGGCGCGGACGGAACCCATCCTTCGACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATG
CAGTACACGTATCCCATCATCGACCGCGAGCGATGGAGGCGAAACCAGATACTCTTGAACAAGTGCCTGCGAGAA
GTCATTGCTCTGCGAACCATTCCGCTGAGGGAGAAGATTGGCCGCGTCTGCTATAATCTTCTCGTTTCTACGTAC
GCGCCGGACATACATCACTACAACACGCTCATCGTCGCCTTTGACGAGGCCGGTCTTCACGCCTTTTCCGAAGCA
ATCATCTGGTCCTTCTTTCATGGACGTCTTCTGCGGCCTACCCCACTGACTTACGTCGCCATTCTCAACCACTGC
AAAGTCGTCGGCAATCATGGGAGATTTCTCATGGTTCTTGCTCGGATAGCAGGTTGCGACTCGGCCATCGGTGGA
AAGATAGCACGGAGGCACATCGAGGACTGCGTCAGTGACGGAGAACTCAACGCGTGGGCCTCAGACACAGACCTA
CGAACACAGATCGGAGAGTGGGTGTTTGAGCACGTCCCGCTCAATCGAGCCATTGTATCCGAGATCATCATCGGC
CTGCTTCGATTTCACATGTTCCATCACGCCGTTCATTTCTTCTTCGCGTGCGTCCAGTGTGAGGTCTTCTTGAGT
GCGGCCGTGGTCAAGAGCCTTCTGGACGAATGCGTGGCTGCTCTTGACTGGAGAGGGGCGTTTGAGTTGATTTAC
GGCCTCCTGGTTCACGACCGGTCTTGGAAGGCCTTTATGTTGACGGGAGACGTCGCCGCGGATTGGTACCTGATC
AACCGGATCTACACCTTGCTCGACATCTGCGGTCTGCGTTACGGCCCGCAGTGGACGTCACGAGAATACCTGGAT
GCTCTGGGTATCCCGCCAGAGAGGCTCGCCGGCCTCTTGTTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGG
CCATGCTTCCCCGAGAGCGTCAAGGGCAAGCCGGACATGGCCATTGGCGCACAAAGCAAGCTCCTACAGCTGGAG
AGCATTTATAAAGAGTACGTCTACGTGAGGAAGACGACGAGGTCGATCGAAAGCAAGCTGTTGTACCCCGATTTC
CCCCTCGAGTGGCGAGTTTCCATGGCTCATCACATCGGAGACGCGGCCCTTCAACAAGCCTCGCAGCTGGTCAAG
GACGTCGAGGACATGCTGAGCAGCATCGTCGGCTTCGGCCCCTGGCTCTACCCAGTCGATTCGGACCGCCGTATG
GAAGCGAGGAAGAGGTATCTCAGGCGCGCCCGTGAGGAGGCCGGTGATGAAGCAGAGACGCGGTTGGAGGGTGAC
GCGACCGAGTCATCACGCACAGAAGCGTCAACAGCGCAGGGCAACCTGGTTTCTACTCAGTGCCCTCGAGAGGCT
GCGGAACGGAAGCAGCAAGAGGCCCTTGTCTCGCAGCTTCGAGCACTCAGGCATGAAGTGGACGAGCCGCACGTC
GAGACGGTTCCGCTGCAAAGCCCCGGACGTTCGGCGCTGGAAGAGGAAATGATTTCGCAGATTCGGGCACTGAGG
CGTGGCGGGGAAGAGCCACCTCCGAAGACAGCAACGTTGCCTCACGAGGTTCATGAAAACACTGCCAGCCTTGTG
GGTAAGAGCGAGTCTCTGGCGCAGTCCGCTGGAACGAAGCGGGAATCGACTGAGCAGCCACCCAAAGGCATGCCT
CTCGCCTTGGTTGTGAGAGAGCAGCATGGCGTCATGGTGCCCTTGCCCGAGGGCTCACGTTTCCTTGACATTATT
CGGACGCGGTACGGACGACCTGATACGTCAGACGAGGGCGTCCTTCAACATGTCCAGAAGCGGCGGGATTCAGCT
GCGCCAAATATGCGCCGTACGGAGACCATACAGAAATCTCGGTGCGATAGGTCAAATCTCGGCCGCGTCATGCGA
GATGTTGGACGATCCGATGCCCGAACTCCTTTGAGAAGCAGGGACAACGAGGTGACAACACGGCAGCCCGTGGCG
AGATGGAACAAGGCAGCCCAGCCGCCCTTGCAAGACGCGCAGCTTGCAACGAGAGAAAGCCAGGAGACGTGGCAG
CAGACGAGGAAATCTGTTGCAACCATACCGGTCTCGCAACGAGGCACGGAGATGAACACGGAACAGCTCATTGCT
CTCTGGAGCCCAACAGCTTACGCATCGAGCAAGACGAAGAGTCGAGCGGACGGCGATGCCGCCGCAGCTGGCAAG
GATTCTCCAGCGAAGCTCAAGTCACGAAAGCGGAATCCAGTCCGAAAAGGCTTGAGACTTCTTCGAAAGGCTGGA
AGGGAACTGACGATGGAACTGCCACTCGAGGCCTTGGCGCCACGACCGGTCGAGCCGACAGTGGAAGACGATCTT
GACGAGGCGGCCCGTGTTGCAGAAGATGCCAAAGACTACACAAACTTTGAGGCTCGAGACTTTGACAGGTGGGCT
AGTCGAATCACGTCTCGAACGCGGCGAGCTCGGACTCGTTTTCGCACGTCCCCTCCGGCTTCTAATGTTTTTGTT
TTGTTCTCGTCTCTCGACAACGACGACGACGACGACGACGATCCGTGGGATGACGACGAGGGAAAACGAAAAGTT
CTCAATTCTGCTACGGTCCCGCACGGCTGGTCGCTGGGCACTGTGATCCGAACAAACGTGGGTTCTCGAAACTCG
CCGGTCGCCGTCGTCTTCGTCTTCGTCTTCGTCTTCGTCGTCGTCGTCGTCTTCGTCGTCTCCGCCGGCATGAAG
TTTGGACGCAGCCTCCCGCGCAACCAGGTGCCCCAGTGGGCGGCCTTCTACATCAACTACAAGGGCCTCAAGAAA
CTGGTCAAGGCGGCGTCGCAGAGAGCCCAAGAGGGCGGCGCCGTTGATCCCGCAGAGCTCTTCTTCGCCCTCGAC
CGCAACCTCGAGGACGTCGACTCGTTCTACAACAAGAAGTTTGCAGAGGCGTGTCGGCGGCTCAACATCCTCCAC
AACCGCTACGGCCGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCGAGGAGGTCATGGCCGCCCTG
CTCGAGCTGAGGACCCAGCTGAGGAACCTGCAGTGGTTCGGCGAGATCAACCGTAGGGGCTTCGTCAAGATCACC
AAGAAGCTCGACAAAAAGGTGCCCGCAATGTCGTCTCAGCACCGCTACATATCCACAAAGGTCGATCCCAAGCCG
TTTGCCAAGGACGGCACCATCGCCCGCCTGCTGGCCGAGATCAACCGCTGGCTATCCGTCCTCGGTGATGCCGAC
AACGTCGACGATTCCACCTCGGACCGCTCCACCCGCTCCCTGGGCCGCGCCTCGGCCAAGGCCATGCTGCTACTG
CCTCAGGCCCAGCTCGACGCCCTGGACCAGGCAGTCCGCAACGATGACGTCGTCGCTCTCAAGTCGGGCGTCGAC
GAGGCCAGTCTCTTGAGCGGTCTCGACGCCCAAGGCCAGAGTCAGGGACAGGGCCTTTTGCTCAACCTGCTCCAG
CGGTCCATCTCGGCACGCTCCCGGGACTGCATGGCCCACCTCCTGGCCTGCATCAAGGACCTGGACGAGCCGGAC
GACATCAACGGCCGCAACTGCATTCACCGGTTCGTCATACACATCGGACGCACCAAGTCGGCGGCGCTGCCCACC
AACGGCGGCGAGCCCTATCCCCAGTTCATCCAGGGCCACATCCAGCCGGCCGTCTCGTCAACGGTCCCCGTCAAG
ACGATCAACACCAAAGAGGAGGACCACCTCGGCGAGGACGACGAGGCCGTCCAGACGCTCCTCTTCCTCCTCGGA
CAGCTGTCGGTGCAGCAGCGGCAGGCCCTCAACAGGCGCGACTCGCTGGGCCGTCTCCCGTTGCACTACGCGGCG
CAGTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGATGCAGGAGTGGAACCAGTTCGACGTCAAGGAC
GGCATCGACGCGCCCGAGTGGCAGGACAAGGACGGCTACGCGCCGCTGCACCTCAGCGTCATCGGGGGCCATCCG
CTCACGACGCAGGCACTGCTCCAGGGCGAGAACTGGCAGGGCAGCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCG
GTGCCCAAGTCGGGGGCGGTGCTGGCGCTGGCGGTCAAGTCCGACTACGAGCCCATCGTCGAGATGCTGGTCAAG
GCGGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGGTGCTGCACATTGCCGCGAGGCATGGCCACGTC
GGCTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGGCGGATCTGGAGACGACGGAGAATGCCTACTCT
TGGACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCGTGGCCCGGCTGCTGATTGAGGCCGGCGCCGAT
GTCTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACGCGGCCCTGCGCGGTCACATGGACATTGCCCGG
ATGCTGGCAGTGCACACCAACGAGGACGAGGCCGTCTCGCGGGTGGCGGCCCGGCTGCAGGCGCCCGAGAACTCG
TCCATTGATGAGCGGCGATCCAATGGCGGGCCACGGCCGGCTGAGCCTGTCAAGAGTTTCGGACATCGTTATCTG
ACCAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCCATGGATATCCGCAAGAGCACCGATGTTGTCAACCTCGAA
TGCGTGCCCCTGACCGAGGCTCACAATACGCAGCTCGATACGGCGCTGTCGGTTGTCGTCAGCGCCAACGGGGCT
CAGGGGGAACCTACAATCATCGACCTGCCGGTACACGAGGGCATCTCGACGGAGCCCGTTGTCTTTACGACGCGA
GACGCTACCAAGGTCAAGCTGCTGTTCGACATCGTCCCGACCTACTCGGGAAGCGAGAAGAACAAGATCGGACGG
GCGGTAGCGCTGCTGTCGTCGATCAAGCCGACGCTGGGCACGCAGCGTGTCAATCTACAGGGCGACGTGTGCGTG
CCCATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACTTTAACTTTCTCGTCATCACGCCCTTTCACCAC
GTCAATATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTATCGTCGACCATGGTCATCGGTCATCGGGGT
CTGGGCAAGAATCTGACGTCCAACAAGTCGCTGCAGCTGGGCGAGAATACGCTGCCGTCCTTCATCGCAGCCGCC
AACCTCGGGGCGCAATATGTCGAGTTCGACGTACAGCTCACCAAGGACCATGTGCCCGTCATCTATCACGACTTC
CTCGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACGCTCACGCTCGAGCAGTTCCTCCACATCAACTCGGAC
AAGAGGCGGGCCGACGGCGGCGCTCCGCTTCAGGGGGGCTCGGGCCGGGATGCGCCCCGGGAGCGGTCGCCGCGG
CCCCGGAGTAACAGCCTGGCGCCGCAGCGGTCGCTGTCGATGGGATACGCCGGTGTCGGTCACGAGGAGATGGAG
GAGCGGATGCGGCACACGCGCGACTTTAAGGAGAAGGGCTACAAGGCCAACTCGCGCGGCAACTTCATCCAGGCG
CCCTTTGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCTGAGGACATTGGCTTCAATATCGAGCTCAAGTACCCG
ATGCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACGCCGTCGAGCTCAACTCGTTTTGCGACACCGTTTTG
GCCAAGGTGTACGATTTGGCTGGCGAGCGGCACATCATCTTTAGCTCCTTCAACCCGGACGTGTGTCTGTGTCTG
AGCTTCAAGCAGCCGTCGATCCCGATTCTGTTTCTGACCGACGCCGGCTGCAGCTCTGTCGGCGATATCCGGGCT
TCATCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGATGGAACCTGCTGGGCATCGTGTCTGCGGCTGAGCCGCTC
ATCAACAGCCCGCGGCTGGTGCGCGTCGTCAAGGAGCTGGGACTGGTGTGCGTCAGCTACGGCGTGCTGAACAAC
GACCCGACGCTGGTTCAGCGGCAAGTCAAGGAGGGCATAGACGCCGTCATCGTCGACAGCGTCCTGGCCATTCGG
AAGGGTCTGACGAGCAATGATACCAGCACGGAGCAGTCGACAGGGACGACGCCCGAGGCCACTGAGAACACGGAG
AACAACAAGACATAG
Transcript >Ophun1|3532
ATGCAGCTCTTCGCAATGGGGCGAGGCCGCACAATCGTCATGTCGGCCGCCGTCGCGGACGCTTCTCGGAAAGGG
CGTCGTCTCATGGAGCTCGACCAGCAGCTGGACGCTGCCCGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATCCG
ACCCCAAAGGAACCCGAGCCGCCGTCTCTCGATGCCGCGATGCCCGAAATCTCTCTCGATCAGATGAAATATCTA
TGGGTCTCTCTCAAAGAGGTGTGGTTCGCTCGACCGTACATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACC
TCGAAGCTCGTGCTGAGTCTCAAAGAGCGCCTCTATGGGAGTCCTTCGGAAAAGAGCATGCAAGATACACGAAAG
ACCGACTACAAGAAATACCATAAAGAAGCTCTGGCCGAGGAATCTGATCCCTCCATCATCACCCGCGAGGCTCAG
AAGGACTCGCATTTGTATCACGAGTCGCGAGCCGTGGAGCAAGTCGTCTTGCAGCTGCTTTCTCGCGCCGCCAAG
ATCCAAACCTGCACCCGGCGCGGACGGAACCCATCCTTCGACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATG
CAGTACACGTATCCCATCATCGACCGCGAGCGATGGAGGCGAAACCAGATACTCTTGAACAAGTGCCTGCGAGAA
GTCATTGCTCTGCGAACCATTCCGCTGAGGGAGAAGATTGGCCGCGTCTGCTATAATCTTCTCGTTTCTACGTAC
GCGCCGGACATACATCACTACAACACGCTCATCGTCGCCTTTGACGAGGCCGGTCTTCACGCCTTTTCCGAAGCA
ATCATCTGGTCCTTCTTTCATGGACGTCTTCTGCGGCCTACCCCACTGACTTACGTCGCCATTCTCAACCACTGC
AAAGTCGTCGGCAATCATGGGAGATTTCTCATGGTTCTTGCTCGGATAGCAGGTTGCGACTCGGCCATCGGTGGA
AAGATAGCACGGAGGCACATCGAGGACTGCGTCAGTGACGGAGAACTCAACGCGTGGGCCTCAGACACAGACCTA
CGAACACAGATCGGAGAGTGGGTGTTTGAGCACGTCCCGCTCAATCGAGCCATTGTATCCGAGATCATCATCGGC
CTGCTTCGATTTCACATGTTCCATCACGCCGTTCATTTCTTCTTCGCGTGCGTCCAGTGTGAGGTCTTCTTGAGT
GCGGCCGTGGTCAAGAGCCTTCTGGACGAATGCGTGGCTGCTCTTGACTGGAGAGGGGCGTTTGAGTTGATTTAC
GGCCTCCTGGTTCACGACCGGTCTTGGAAGGCCTTTATGTTGACGGGAGACGTCGCCGCGGATTGGTACCTGATC
AACCGGATCTACACCTTGCTCGACATCTGCGGTCTGCGTTACGGCCCGCAGTGGACGTCACGAGAATACCTGGAT
GCTCTGGGTATCCCGCCAGAGAGGCTCGCCGGCCTCTTGTTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGG
CCATGCTTCCCCGAGAGCGTCAAGGGCAAGCCGGACATGGCCATTGGCGCACAAAGCAAGCTCCTACAGCTGGAG
AGCATTTATAAAGAGTACGTCTACGTGAGGAAGACGACGAGGTCGATCGAAAGCAAGCTGTTGTACCCCGATTTC
CCCCTCGAGTGGCGAGTTTCCATGGCTCATCACATCGGAGACGCGGCCCTTCAACAAGCCTCGCAGCTGGTCAAG
GACGTCGAGGACATGCTGAGCAGCATCGTCGGCTTCGGCCCCTGGCTCTACCCAGTCGATTCGGACCGCCGTATG
GAAGCGAGGAAGAGGTATCTCAGGCGCGCCCGTGAGGAGGCCGGTGATGAAGCAGAGACGCGGTTGGAGGGTGAC
GCGACCGAGTCATCACGCACAGAAGCGTCAACAGCGCAGGGCAACCTGGTTTCTACTCAGTGCCCTCGAGAGGCT
GCGGAACGGAAGCAGCAAGAGGCCCTTGTCTCGCAGCTTCGAGCACTCAGGCATGAAGTGGACGAGCCGCACGTC
GAGACGGTTCCGCTGCAAAGCCCCGGACGTTCGGCGCTGGAAGAGGAAATGATTTCGCAGATTCGGGCACTGAGG
CGTGGCGGGGAAGAGCCACCTCCGAAGACAGCAACGTTGCCTCACGAGGTTCATGAAAACACTGCCAGCCTTGTG
GGTAAGAGCGAGTCTCTGGCGCAGTCCGCTGGAACGAAGCGGGAATCGACTGAGCAGCCACCCAAAGGCATGCCT
CTCGCCTTGGTTGTGAGAGAGCAGCATGGCGTCATGGTGCCCTTGCCCGAGGGCTCACGTTTCCTTGACATTATT
CGGACGCGGTACGGACGACCTGATACGTCAGACGAGGGCGTCCTTCAACATGTCCAGAAGCGGCGGGATTCAGCT
GCGCCAAATATGCGCCGTACGGAGACCATACAGAAATCTCGGTGCGATAGGTCAAATCTCGGCCGCGTCATGCGA
GATGTTGGACGATCCGATGCCCGAACTCCTTTGAGAAGCAGGGACAACGAGGTGACAACACGGCAGCCCGTGGCG
AGATGGAACAAGGCAGCCCAGCCGCCCTTGCAAGACGCGCAGCTTGCAACGAGAGAAAGCCAGGAGACGTGGCAG
CAGACGAGGAAATCTGTTGCAACCATACCGGTCTCGCAACGAGGCACGGAGATGAACACGGAACAGCTCATTGCT
CTCTGGAGCCCAACAGCTTACGCATCGAGCAAGACGAAGAGTCGAGCGGACGGCGATGCCGCCGCAGCTGGCAAG
GATTCTCCAGCGAAGCTCAAGTCACGAAAGCGGAATCCAGTCCGAAAAGGCTTGAGACTTCTTCGAAAGGCTGGA
AGGGAACTGACGATGGAACTGCCACTCGAGGCCTTGGCGCCACGACCGGTCGAGCCGACAGTGGAAGACGATCTT
GACGAGGCGGCCCGTGTTGCAGAAGATGCCAAAGACTACACAAACTTTGAGGCTCGAGACTTTGACAGGTGGGCT
AGTCGAATCACGTCTCGAACGCGGCGAGCTCGGACTCGTTTTCGCACGTCCCCTCCGGCTTCTAATGTTTTTGTT
TTGTTCTCGTCTCTCGACAACGACGACGACGACGACGACGATCCGTGGGATGACGACGAGGGAAAACGAAAAGTT
CTCAATTCTGCTACGGTCCCGCACGGCTGGTCGCTGGGCACTGTGATCCGAACAAACGTGGGTTCTCGAAACTCG
CCGGTCGCCGTCGTCTTCGTCTTCGTCTTCGTCTTCGTCGTCGTCGTCGTCTTCGTCGTCTCCGCCGGCATGAAG
TTTGGACGCAGCCTCCCGCGCAACCAGGTGCCCCAGTGGGCGGCCTTCTACATCAACTACAAGGGCCTCAAGAAA
CTGGTCAAGGCGGCGTCGCAGAGAGCCCAAGAGGGCGGCGCCGTTGATCCCGCAGAGCTCTTCTTCGCCCTCGAC
CGCAACCTCGAGGACGTCGACTCGTTCTACAACAAGAAGTTTGCAGAGGCGTGTCGGCGGCTCAACATCCTCCAC
AACCGCTACGGCCGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCGAGGAGGTCATGGCCGCCCTG
CTCGAGCTGAGGACCCAGCTGAGGAACCTGCAGTGGTTCGGCGAGATCAACCGTAGGGGCTTCGTCAAGATCACC
AAGAAGCTCGACAAAAAGGTGCCCGCAATGTCGTCTCAGCACCGCTACATATCCACAAAGGTCGATCCCAAGCCG
TTTGCCAAGGACGGCACCATCGCCCGCCTGCTGGCCGAGATCAACCGCTGGCTATCCGTCCTCGGTGATGCCGAC
AACGTCGACGATTCCACCTCGGACCGCTCCACCCGCTCCCTGGGCCGCGCCTCGGCCAAGGCCATGCTGCTACTG
CCTCAGGCCCAGCTCGACGCCCTGGACCAGGCAGTCCGCAACGATGACGTCGTCGCTCTCAAGTCGGGCGTCGAC
GAGGCCAGTCTCTTGAGCGGTCTCGACGCCCAAGGCCAGAGTCAGGGACAGGGCCTTTTGCTCAACCTGCTCCAG
CGGTCCATCTCGGCACGCTCCCGGGACTGCATGGCCCACCTCCTGGCCTGCATCAAGGACCTGGACGAGCCGGAC
GACATCAACGGCCGCAACTGCATTCACCGGTTCGTCATACACATCGGACGCACCAAGTCGGCGGCGCTGCCCACC
AACGGCGGCGAGCCCTATCCCCAGTTCATCCAGGGCCACATCCAGCCGGCCGTCTCGTCAACGGTCCCCGTCAAG
ACGATCAACACCAAAGAGGAGGACCACCTCGGCGAGGACGACGAGGCCGTCCAGACGCTCCTCTTCCTCCTCGGA
CAGCTGTCGGTGCAGCAGCGGCAGGCCCTCAACAGGCGCGACTCGCTGGGCCGTCTCCCGTTGCACTACGCGGCG
CAGTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGATGCAGGAGTGGAACCAGTTCGACGTCAAGGAC
GGCATCGACGCGCCCGAGTGGCAGGACAAGGACGGCTACGCGCCGCTGCACCTCAGCGTCATCGGGGGCCATCCG
CTCACGACGCAGGCACTGCTCCAGGGCGAGAACTGGCAGGGCAGCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCG
GTGCCCAAGTCGGGGGCGGTGCTGGCGCTGGCGGTCAAGTCCGACTACGAGCCCATCGTCGAGATGCTGGTCAAG
GCGGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGGTGCTGCACATTGCCGCGAGGCATGGCCACGTC
GGCTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGGCGGATCTGGAGACGACGGAGAATGCCTACTCT
TGGACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCGTGGCCCGGCTGCTGATTGAGGCCGGCGCCGAT
GTCTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACGCGGCCCTGCGCGGTCACATGGACATTGCCCGG
ATGCTGGCAGTGCACACCAACGAGGACGAGGCCGTCTCGCGGGTGGCGGCCCGGCTGCAGGCGCCCGAGAACTCG
TCCATTGATGAGCGGCGATCCAATGGCGGGCCACGGCCGGCTGAGCCTGTCAAGAGTTTCGGACATCGTTATCTG
ACCAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCCATGGATATCCGCAAGAGCACCGATGTTGTCAACCTCGAA
TGCGTGCCCCTGACCGAGGCTCACAATACGCAGCTCGATACGGCGCTGTCGGTTGTCGTCAGCGCCAACGGGGCT
CAGGGGGAACCTACAATCATCGACCTGCCGGTACACGAGGGCATCTCGACGGAGCCCGTTGTCTTTACGACGCGA
GACGCTACCAAGGTCAAGCTGCTGTTCGACATCGTCCCGACCTACTCGGGAAGCGAGAAGAACAAGATCGGACGG
GCGGTAGCGCTGCTGTCGTCGATCAAGCCGACGCTGGGCACGCAGCGTGTCAATCTACAGGGCGACGTGTGCGTG
CCCATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACTTTAACTTTCTCGTCATCACGCCCTTTCACCAC
GTCAATATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTATCGTCGACCATGGTCATCGGTCATCGGGGT
CTGGGCAAGAATCTGACGTCCAACAAGTCGCTGCAGCTGGGCGAGAATACGCTGCCGTCCTTCATCGCAGCCGCC
AACCTCGGGGCGCAATATGTCGAGTTCGACGTACAGCTCACCAAGGACCATGTGCCCGTCATCTATCACGACTTC
CTCGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACGCTCACGCTCGAGCAGTTCCTCCACATCAACTCGGAC
AAGAGGCGGGCCGACGGCGGCGCTCCGCTTCAGGGGGGCTCGGGCCGGGATGCGCCCCGGGAGCGGTCGCCGCGG
CCCCGGAGTAACAGCCTGGCGCCGCAGCGGTCGCTGTCGATGGGATACGCCGGTGTCGGTCACGAGGAGATGGAG
GAGCGGATGCGGCACACGCGCGACTTTAAGGAGAAGGGCTACAAGGCCAACTCGCGCGGCAACTTCATCCAGGCG
CCCTTTGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCTGAGGACATTGGCTTCAATATCGAGCTCAAGTACCCG
ATGCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACGCCGTCGAGCTCAACTCGTTTTGCGACACCGTTTTG
GCCAAGGTGTACGATTTGGCTGGCGAGCGGCACATCATCTTTAGCTCCTTCAACCCGGACGTGTGTCTGTGTCTG
AGCTTCAAGCAGCCGTCGATCCCGATTCTGTTTCTGACCGACGCCGGCTGCAGCTCTGTCGGCGATATCCGGGCT
TCATCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGATGGAACCTGCTGGGCATCGTGTCTGCGGCTGAGCCGCTC
ATCAACAGCCCGCGGCTGGTGCGCGTCGTCAAGGAGCTGGGACTGGTGTGCGTCAGCTACGGCGTGCTGAACAAC
GACCCGACGCTGGTTCAGCGGCAAGTCAAGGAGGGCATAGACGCCGTCATCGTCGACAGCGTCCTGGCCATTCGG
AAGGGTCTGACGAGCAATGATACCAGCACGGAGCAGTCGACAGGGACGACGCCCGAGGCCACTGAGAACACGGAG
AACAACAAGACATAG
Gene >Ophun1|3532
ATGCAGCTCTTCGCAATGGGGCGAGGCCGGTGACGAGGACTGCTCGGGGGCGCAGACCGTCGCTTGCAGGCATTC
TAACGGCTTGTTACAGCACAATCGTCATGTCGGCCGCCGTCGCGGACGCTTCTCGGAAAGGGCGTCGTCTCATGG
AGCTCGACCAGCAGCTGGACGCTGCCCGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATCCGACCCCAAAGGAAC
CCGAGCCGCCGTCTCTCGATGCCGCGATGCCCGAAATCTCTCTCGATCAGATGAAATATCTATGGGTCTCTCTCA
AAGAGGTGTGGTTCGCTCGACCGTACATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACCTCGAAGCTCGTGC
TGAGTCTCAAAGAGCGCCTCTATGGGAGTCCTTCGGAAAAGAGCATGCAAGATACACGAAAGACCGACTACAAGA
AATACCATAAAGAAGCTCTGGCCGAGGAATCTGATCCCTCCATCATCACCCGCGAGGCTCAGAAGGACTCGCATT
TGTATCACGAGTCGCGAGCCGTGGAGCAAGTCGTCTTGCAGCTGCTTTCTCGCGCCGCCAAGATCCAAACCTGCA
CCCGGCGCGGACGGAACCCATCCTTCGACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATGCAGTACACGTATC
CCATCATCGACCGCGAGCGATGGAGGCGAAACCAGATACTCTTGAACAAGTGCCTGCGAGAAGTCATTGCTCTGC
GAACCATTCCGCTGAGGGAGAAGATTGGCCGCGTCTGCTATAATCTTCTCGTTTCTACGTACGCGCCGGACATAC
ATCACTACAACACGCTCATCGTCGCCTTTGACGAGGCCGGTCTTCACGCCTTTTCCGAAGCAATCATCTGGTCCT
TCTTTCATGGACGTCTTCTGCGGCCTACCCCACTGACTTACGTCGCCATTCTCAACCACTGCAAAGTCGTCGGCA
ATCATGGGAGATTTCTCATGGTTCTTGCTCGGATAGCAGGTTGCGACTCGGCCATCGGTGGAAAGATAGCACGGA
GGCACATCGAGGACTGCGTCAGTGACGGAGAACTCAACGCGTGGGCCTCAGACACAGACCTACGAACACAGATCG
GAGAGTGGGTGTTTGAGCACGTCCCGCTCAATCGAGCCATTGTATCCGAGATCATCATCGGCCTGCTTCGATTTC
ACATGTTCCATCACGCCGTTCATTTCTTCTTCGCGTGCGTCCAGTGTGAGGTCTTCTTGAGTGCGGCCGTGGTCA
AGAGCCTTCTGGACGAATGCGTGGCTGCTCTTGACTGGAGAGGGGCGTTTGAGTTGATTTACGGCCTCCTGGTTC
ACGACCGGTCTTGGAAGGCCTTTATGTTGACGGGAGACGTCGCCGCGGATTGGTACCTGATCAACCGGATCTACA
CCTTGCTCGACATCTGCGGTCTGCGTTACGGCCCGCAGTGGACGTCACGAGAATACCTGGATGCTCTGGGTATCC
CGCCAGAGAGGCTCGCCGGCCTCTTGTTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGGCCATGCTTCCCCG
AGAGCGTCAAGGGCAAGCCGGACATGGCCATTGGCGCACAAAGCAAGCTCCTACAGCTGGAGAGCATTTATAAAG
AGTACGTCTACGTGAGGAAGACGACGAGGTCGATCGAAAGCAAGCTGTTGTACCCCGATTTCCCCCTCGAGTGGC
GAGTTTCCATGGCTCATCACATCGGAGACGCGGCCCTTCAACAAGCCTCGCAGCTGGTCAAGGACGTCGAGGACA
TGCTGAGCAGCATCGTCGGCTTCGGCCCCTGGCTCTACCCAGTCGATTCGGACCGCCGTATGGAAGCGAGGAAGA
GGTATCTCAGGCGCGCCCGTGAGGAGGCCGGTGATGAAGCAGAGACGCGGTTGGAGGGTGACGCGACCGAGTCAT
CACGCACAGAAGCGTCAACAGCGCAGGGCAACCTGGTTTCTACTCAGTGCCCTCGAGAGGCTGCGGAACGGAAGC
AGCAAGAGGCCCTTGTCTCGCAGCTTCGAGCACTCAGGCATGAAGTGGACGAGCCGCACGTCGAGACGGTTCCGC
TGCAAAGCCCCGGACGTTCGGCGCTGGAAGAGGAAATGATTTCGCAGATTCGGGCACTGAGGCGTGGCGGGGAAG
AGCCACCTCCGAAGACAGCAACGTTGCCTCACGAGGTTCATGAAAACACTGCCAGCCTTGTGGGTAAGAGCGAGT
CTCTGGCGCAGTCCGCTGGAACGAAGCGGGAATCGACTGAGCAGCCACCCAAAGGCATGCCTCTCGCCTTGGTTG
TGAGAGAGCAGCATGGCGTCATGGTGCCCTTGCCCGAGGGCTCACGTTTCCTTGACATTATTCGGACGCGGTACG
GACGACCTGATACGTCAGACGAGGGCGTCCTTCAACATGTCCAGAAGCGGCGGGATTCAGCTGCGCCAAATATGC
GCCGTACGGAGACCATACAGAAATCTCGGTGCGATAGGTCAAATCTCGGCCGCGTCATGCGAGATGTTGGACGAT
CCGATGCCCGAACTCCTTTGAGAAGCAGGGACAACGAGGTGACAACACGGCAGCCCGTGGCGAGATGGAACAAGG
CAGCCCAGCCGCCCTTGCAAGACGCGCAGCTTGCAACGAGAGAAAGCCAGGAGACGTGGCAGCAGACGAGGAAAT
CTGTTGCAACCATACCGGTCTCGCAACGAGGCACGGAGATGAACACGGAACAGCTCATTGCTCTCTGGAGCCCAA
CAGCTTACGCATCGAGCAAGACGAAGAGTCGAGCGGACGGCGATGCCGCCGCAGCTGGCAAGGATTCTCCAGCGA
AGCTCAAGTCACGAAAGCGGAATCCAGTCCGAAAAGGCTTGAGACTTCTTCGAAAGGCTGGAAGGGAACTGACGA
TGGAACTGCCACTCGAGGCCTTGGCGCCACGACCGGTCGAGCCGACAGTGGAAGACGATCTTGACGAGGCGGCCC
GTGTTGCAGAAGATGCCAAAGACTACACAAACGTGAGGATTGCAAGAAAGTCGAAAAAAGCCAAATCGTCAAAAA
AAGGCAGGCATCCCGCAACGGCCGATATCGCCCAAGAACAAGATTCACCAAGGTCGCGGATGAAGCGCCAAGCGG
CCAAGCCGTCAGACAGAATGGCCCATGTCTCGGAAGGCTCCGGTGACGTGAGGACTACGAATACAATGGGGTCGG
CATCGAAGACAAAGTTGTCAGACAGAGACAAGTCGGGCGCACAAACCGGCCCACTGTCTCGGCAGTCATCAAAGG
AGCTGAAAAGGCATAACGGCGGACGGCTTCCAGACGGCGAGAAGTCACGTCGCCACTCGGTCGATGCAGGAGCAG
GGGCAGGCGCCGGAGCGGGAGCGAAATAGCTGGCAAAAGACATGAAGCAGCGACTGCAGCACGCAGGCTGGGCGG
GCGGCCGGGGAGAGGCCGGGGAGGCAGTGGAATGACGGTGGCTGCAGCGCCGCTTGGTGCAGCCCAGCCCAATGG
TGGCTGGCCCAGGCTGGGGGGCAGCGGATGTCGCGGTGATTGTGGAGGGCAATGTGGACTGTCTGTGGTCTGCTG
GAACCTCTGCTGGAACCTCTGATGGAGTCGGATGGAGTCGATATGGAGCCAGTTGGGAGGAAGAAGAGAGGAGGG
CAGGCCGGCCCGGAAGCCGGAAATGAGAAGGATGCTGAGTCATCGGGGTCCTGTGACGTGACGTGTATCGTAGGT
TCCAACGATGGAGGATGGTTTATATTGGTATATCCATTCTGTTGGTTGTGGGCAGCCTTGCCCTGTTGGGAGAGG
CGGCAGTTTGAGGCTCGAGACTTTGACAGGTGGGCTAGTCGAATCACGTCTCGAACGCGGCGAGCTCGGACTCGT
TTTCGCACGTCCCCTCCGGCTTCTAATGTTTTTGTTTTGTTCTCGTCTCTCGACAACGACGACGACGACGACGAC
GATCCGTGGGATGACGACGAGGGAAAACGAAAAGTTCTCAATTCTGCTACGGTCCCGCGTTTACGAAGAACAATG
CATTAGCCAGCTAACCGCGCCGCACCGTGAGACGGCTGGTCGCTGGGCACTGTGATCCGAACAAACGTGGGTTCT
CGAAACTCGCCGGTCGCCGTCGTCTTCGTCTTCGTCTTCGTCTTCGTCGTCGTCGTCGTCTTCGTCGTCTCCGCC
GGCATGAAGTTTGGACGCAGGTGAGCCTTCTCTTCTCTTCCAGACATGTCGTTGTCAGGAGAACTTGGGGGCTGA
GTTTCCTCCCCCCTTCGACGGATGACAGCCTCCCGCGCAACCAGGTGCCCCAGTGGGCGGCCTTCTACATCAACT
ACAAGGGCCTCAAGAAACTGGTCAAGGCGGCGTCGCAGAGAGCCCAAGAGGGCGGCGCCGTTGATCCCGCAGGTG
GGCGCGACCACCAGATGGCAGGCCGTCCCTTCACCCCCCTAACTCACCAGCAGAGCTCTTCTTCGCCCTCGACCG
CAACCTCGAGGACGTCGACTCGTTCTACAACAAGAAGTTTGCAGAGGCGTGTCGGCGGCTCAACATCCTCCACAA
CCGCTACGGCCGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCGAGGAGGTCATGGCCGCCCTGCT
CGAGCTGAGGACCCAGCTGAGGAACCTGCAGTGGTTCGGCGAGATCAACCGTAGGGGCTTCGTCAAGATCACCAA
GAAGCTCGACAAAAAGGTGCCCGCAATGTCGTCTCAGCACCGCTACATATCCACAAAGGTCGATCCCAAGCCGTT
TGCCAAGGACGGCACCATCGCCCGCCTGCTGGCCGAGATCAACCGCTGGCTATCCGTCCTCGGTGATGCCGACAA
CGTCGACGATTCCACCTCGGACCGCTCCACCCGCTCCCTGGGCCGCGCCTCGGCCAAGGCCATGCTGCTACTGCC
TCAGGCCCAGCTCGACGCCCTGGACCAGGCAGTCCGCAACGATGACGTCGTCGCTCTCAAGTCGGGCGTCGACGA
GGCCAGTCTCTTGAGCGGTCTCGACGCCCAAGGCCAGAGTCAGGGACAGGGCCTTTTGCTCAACCTGCTCCAGCG
GTCCATCTCGGCACGCTCCCGGGACTGCATGGCCCACCTCCTGGCCTGCATCAAGGACCTGGACGAGCCGGACGA
CATCAACGGCCGCAACTGCATTCACCGGTTCGTCATACACATCGGACGCACCAAGTCGGCGGCGCTGCCCACCAA
CGGCGGCGAGCCCTATCCCCAGTTCATCCAGGGCCACATCCAGCCGGCCGTCTCGTCAACGGTCCCCGTCAAGAC
GATCAACACCAAAGAGGAGGACCACCTCGGCGAGGACGACGAGGCCGTCCAGACGCTCCTCTTCCTCCTCGGACA
GCTGTCGGTGCAGCAGCGGCAGGCCCTCAACAGGCGCGACTCGCTGGGCCGTCTCCCGTTGCACTACGCGGCGCA
GTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGATGCAGGAGTGGAACCAGTTCGACGTCAAGGACGG
CATCGACGCGCCCGAGTGGCAGGACAAGGACGGCTACGCGCCGCTGCACCTCAGCGTCATCGGGGGCCATCCGCT
CACGACGCAGGCACTGCTCCAGGGCGAGAACTGGCAGGGCAGCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCGGT
GCCCAAGTCGGGGGCGGTGCTGGCGCTGGCGGTCAAGTCCGACTACGAGCCCATCGTCGAGATGCTGGTCAAGGC
GGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGGTGCTGCACATTGCCGCGAGGCATGGCCACGTCGG
CTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGGCGGATCTGGAGACGACGGAGAATGCCTACTCTTG
GACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCGTGGCCCGGCTGCTGATTGAGGCCGGCGCCGATGT
CTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACGCGGCCCTGCGCGGTCACATGGACATTGCCCGGAT
GCTGGCAGTGCACACCAACGAGGACGAGGCCGTCTCGCGGGTGGCGGCCCGGCTGCAGGCGCCCGAGAACTCGTC
CATTGATGAGCGGCGATCCAATGGCGGGCCACGGCCGGCTGAGCCTGTCAAGAGTTTCGGACATCGTTATCTGAC
CAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCCATGGATATCCGCAAGAGCACCGATGTTGTCAACCTCGAATG
CGTGCCCCTGACCGAGGCTCACAATACGCAGCTCGATACGGCGCTGTCGGTTGTCGTCAGCGCCAACGGGGCTCA
GGGGGAACCTACAATCATCGACCTGCCGGTACACGAGGGCATCTCGACGGAGCCCGTTGTCTTTACGACGCGAGA
CGCTACCAAGGTCAAGCTGCTGTTCGACATCGTCCCGACCTACTCGGGAAGCGAGAAGAACAAGATCGGACGGGC
GGTAGCGCTGCTGTCGTCGATCAAGCCGACGCTGGGCACGCAGCGTGTCAATCTACAGGGCGACGTGTGCGTGCC
CATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACTTTAACTTTCTCGTCATCACGCCCTTTCACCACGT
CAATATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTATCGTCGACCATGGTCATCGGTCATCGGGGTCT
GGGCAAGAATCTGACGTCCAACAAGTCGCTGCAGCTGGGCGAGAATACGCTGCCGTCCTTCATCGCAGCCGCCAA
CCTCGGGGCGCAATATGTCGAGTTCGACGTACAGCTCACCAAGGACCATGTGCCCGTCATCTATCACGACTTCCT
CGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACGCTCACGCTCGAGCAGTTCCTCCACATCAACTCGGACAA
GAGGCGGGCCGACGGCGGCGCTCCGCTTCAGGGGGGCTCGGGCCGGGATGCGCCCCGGGAGCGGTCGCCGCGGCC
CCGGAGTAACAGCCTGGCGCCGCAGCGGTCGCTGTCGATGGGATACGCCGGTGTCGGTCACGAGGAGATGGAGGA
GCGGATGCGGCACACGCGCGACTTTAAGGAGAAGGGCTACAAGGCCAACTCGCGCGGCAACTTCATCCAGGCGCC
CTTTGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCTGAGGACATTGGCTTCAATATCGAGCTCAAGTACCCGAT
GCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACGCCGTCGAGCTCAACTCGTTTTGCGACACCGTTTTGGC
CAAGGTGTACGATTTGGCTGGCGAGCGGCACATCATCTTTAGCTCCTTCAACCCGGACGTGTGTCTGTGTCTGAG
CTTCAAGCAGCCGTCGATCCCGATTCTGTTTCTGACCGACGCCGGCTGCAGCTCTGTCGGCGATATCCGGGCTTC
ATCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGATGGAACCTGCTGGGCATCGTGTCTGCGGCTGAGCCGCTCAT
CAACAGCCCGCGGCTGGTGCGCGTCGTCAAGGAGCTGGGACTGGTGTGCGTCAGCTACGGCGTGCTGAACAACGA
CCCGACGCTGGTTCAGGTGGGATCCCCTTTCTCCCTTGGTTATCTGTATGTCTGAATCTGGCTGACGGAAGCTCT
GGGACAGCGGCAAGTCAAGGAGGGCATAGACGCCGTCATCGTCGACAGCGTCCTGGCCATTCGGAAGGGTCTGAC
GAGCAATGATACCAGCACGGAGCAGTCGACAGGGACGACGCCCGAGGCCACTGAGAACACGGAGAACAACAAGAC
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail