Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3529
Gene name
LocationContig_313:4840..6115
Strand-
Gene length (bp)1275
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03367 zf-ZPR1 ZPR1 zinc-finger domain 1.3E-47 18 165
PF03367 zf-ZPR1 ZPR1 zinc-finger domain 1.5E-55 215 382

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 19 424 4.0E-129
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 19 417 6.0E-120
sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens GN=ZPR1 PE=1 SV=1 4 419 2.0E-100
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 19 419 3.0E-99
sp|A9CB27|ZPR1_PAPAN Zinc finger protein ZPR1 OS=Papio anubis GN=ZNF259 PE=3 SV=1 4 419 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 19 424 4.0E-129
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 19 417 6.0E-120
sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens GN=ZPR1 PE=1 SV=1 4 419 2.0E-100
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 19 419 3.0E-99
sp|A9CB27|ZPR1_PAPAN Zinc finger protein ZPR1 OS=Papio anubis GN=ZNF259 PE=3 SV=1 4 419 1.0E-98
sp|Q2TBX0|ZPR1_BOVIN Zinc finger protein ZPR1 OS=Bos taurus GN=ZNF259 PE=2 SV=1 4 419 2.0E-97
sp|Q55E13|ZPR1_DICDI Zinc finger protein ZPR1 homolog OS=Dictyostelium discoideum GN=zpr1 PE=3 SV=1 18 420 1.0E-86
sp|O16999|ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans GN=W03F9.1 PE=3 SV=2 19 421 8.0E-82
sp|Q55E13|ZPR1_DICDI Zinc finger protein ZPR1 homolog OS=Dictyostelium discoideum GN=zpr1 PE=3 SV=1 17 193 2.0E-26
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 209 413 1.0E-23
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 216 411 6.0E-22
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 13 195 1.0E-17
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 185 411 2.0E-17
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 11 195 3.0E-15
sp|O16999|ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans GN=W03F9.1 PE=3 SV=2 216 413 1.0E-13
sp|Q57950|Y530_METJA Uncharacterized ZPR1-like protein MJ0530 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0530 PE=3 SV=1 216 381 1.0E-11
sp|O58960|Y1223_PYRHO Uncharacterized ZPR1-like protein PH1223 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1223 PE=3 SV=1 216 379 2.0E-08
sp|Q57950|Y530_METJA Uncharacterized ZPR1-like protein MJ0530 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0530 PE=3 SV=1 28 112 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3853
Ophiocordyceps australis map64 (Brazil) OphauB2|301
Ophiocordyceps camponoti-floridani Ophcf2|04944
Ophiocordyceps camponoti-rufipedis Ophun1|3529 (this protein)
Ophiocordyceps kimflemingae Ophio5|7616
Ophiocordyceps subramaniannii Hirsu2|6311

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3529
MQVDALQPPTSTPSNLIQGITRLLLTAIPYFRQVVIMSFSCEHCHAQNNEIQAAGSVQPQGVHYELRLTSLADFN
RQVVKSDTATVKFIELDLEMPPGRGQLTNVEGLLTTIITDLEPGQPTRKEQTPEIHDKIAHIISKGHAMLAGTAF
PFRLSIDDPTGNSFISPDLKDGIGKWQKREYPRSADQNAALGLPDTAPSASHPETPDEVYDFPASCPSCAHACTT
NMKMVDIPHFKQVILMSTLCDSCGYRSTDVKTGGEIPPKGQRTTLTVTDAKDLTRDILKSESCALSCPELKLHVN
PGTLGSRFTTVEGLLSQVRSDLHSHIFSDDAPANDGRTAADSLAADDKQNWSSFFATLDAAIAGETPFTLILTDP
LSASFIQPLAEPPSEDARLRREDYDRSAEEEDELGLSDMRTEGYVEEGG*
Coding >Ophun1|3529
ATGCAAGTCGACGCCCTCCAACCCCCAACGTCTACCCCGTCTAACCTCATCCAGGGCATCACCAGACTTCTCCTC
ACAGCAATCCCCTACTTCCGCCAAGTCGTCATCATGTCCTTCTCCTGCGAACACTGCCACGCCCAAAACAACGAG
ATCCAAGCCGCCGGCTCCGTCCAACCCCAAGGCGTACACTACGAACTCCGCCTCACCTCCCTCGCCGACTTCAAC
CGCCAAGTCGTAAAATCAGACACGGCAACCGTCAAATTCATAGAGCTGGACCTCGAAATGCCCCCCGGCCGCGGC
CAGCTCACCAACGTCGAAGGCCTCCTCACCACCATAATCACCGACCTCGAACCAGGCCAACCAACCCGCAAAGAA
CAAACCCCCGAAATCCACGACAAAATCGCACACATCATCTCAAAAGGCCACGCCATGCTCGCAGGAACCGCCTTT
CCCTTCCGCCTCTCCATCGACGACCCAACCGGCAACTCCTTCATCTCCCCCGACCTCAAAGACGGAATAGGCAAA
TGGCAAAAACGCGAATACCCCCGCTCAGCAGATCAAAACGCCGCCCTCGGCCTCCCAGACACCGCCCCCTCCGCC
TCCCACCCCGAAACCCCCGACGAGGTCTACGACTTCCCCGCCTCATGCCCCAGCTGCGCCCACGCCTGCACAACA
AACATGAAGATGGTCGACATCCCCCACTTCAAACAAGTAATCCTCATGTCCACCCTCTGCGACTCCTGCGGCTAC
CGCTCCACCGACGTCAAAACCGGCGGCGAGATCCCCCCCAAAGGCCAACGCACAACCCTCACCGTCACCGACGCC
AAAGACCTCACCCGCGACATCCTCAAAAGCGAATCCTGCGCCCTCTCCTGCCCAGAGCTCAAGCTACACGTCAAC
CCCGGCACCCTCGGCAGCCGCTTCACAACGGTAGAGGGCCTCCTCTCCCAAGTCCGCTCCGACCTCCACAGCCAC
ATCTTCTCCGACGACGCCCCCGCCAACGACGGCAGAACAGCAGCAGACTCCCTCGCCGCAGACGACAAACAGAAC
TGGTCCTCCTTCTTCGCAACCCTCGACGCCGCCATCGCAGGCGAAACGCCCTTCACCCTCATCCTCACCGACCCC
CTATCCGCGAGCTTCATCCAACCCCTCGCCGAGCCCCCTTCCGAAGACGCGCGTCTCCGGCGAGAGGACTATGAT
CGCTCGGCGGAGGAGGAGGATGAGTTGGGGCTTAGCGATATGCGGACTGAGGGGTATGTTGAGGAGGGGGGGTAG
Transcript >Ophun1|3529
ATGCAAGTCGACGCCCTCCAACCCCCAACGTCTACCCCGTCTAACCTCATCCAGGGCATCACCAGACTTCTCCTC
ACAGCAATCCCCTACTTCCGCCAAGTCGTCATCATGTCCTTCTCCTGCGAACACTGCCACGCCCAAAACAACGAG
ATCCAAGCCGCCGGCTCCGTCCAACCCCAAGGCGTACACTACGAACTCCGCCTCACCTCCCTCGCCGACTTCAAC
CGCCAAGTCGTAAAATCAGACACGGCAACCGTCAAATTCATAGAGCTGGACCTCGAAATGCCCCCCGGCCGCGGC
CAGCTCACCAACGTCGAAGGCCTCCTCACCACCATAATCACCGACCTCGAACCAGGCCAACCAACCCGCAAAGAA
CAAACCCCCGAAATCCACGACAAAATCGCACACATCATCTCAAAAGGCCACGCCATGCTCGCAGGAACCGCCTTT
CCCTTCCGCCTCTCCATCGACGACCCAACCGGCAACTCCTTCATCTCCCCCGACCTCAAAGACGGAATAGGCAAA
TGGCAAAAACGCGAATACCCCCGCTCAGCAGATCAAAACGCCGCCCTCGGCCTCCCAGACACCGCCCCCTCCGCC
TCCCACCCCGAAACCCCCGACGAGGTCTACGACTTCCCCGCCTCATGCCCCAGCTGCGCCCACGCCTGCACAACA
AACATGAAGATGGTCGACATCCCCCACTTCAAACAAGTAATCCTCATGTCCACCCTCTGCGACTCCTGCGGCTAC
CGCTCCACCGACGTCAAAACCGGCGGCGAGATCCCCCCCAAAGGCCAACGCACAACCCTCACCGTCACCGACGCC
AAAGACCTCACCCGCGACATCCTCAAAAGCGAATCCTGCGCCCTCTCCTGCCCAGAGCTCAAGCTACACGTCAAC
CCCGGCACCCTCGGCAGCCGCTTCACAACGGTAGAGGGCCTCCTCTCCCAAGTCCGCTCCGACCTCCACAGCCAC
ATCTTCTCCGACGACGCCCCCGCCAACGACGGCAGAACAGCAGCAGACTCCCTCGCCGCAGACGACAAACAGAAC
TGGTCCTCCTTCTTCGCAACCCTCGACGCCGCCATCGCAGGCGAAACGCCCTTCACCCTCATCCTCACCGACCCC
CTATCCGCGAGCTTCATCCAACCCCTCGCCGAGCCCCCTTCCGAAGACGCGCGTCTCCGGCGAGAGGACTATGAT
CGCTCGGCGGAGGAGGAGGATGAGTTGGGGCTTAGCGATATGCGGACTGAGGGGTATGTTGAGGAGGGGGGGTAG
Gene >Ophun1|3529
ATGCAAGTCGACGCCCTCCAACCCCCAACGTCTACCCCGTCTAACCTCATCCAGGGCATCACCAGACTTCTCCTC
ACAGCAATCCCCTACTTCCGCCAAGTCGTCATCATGTCCTTCTCCTGCGAACACTGCCACGCCCAAAACAACGAG
ATCCAAGCCGCCGGCTCCGTCCAACCCCAAGGCGTACACTACGAACTCCGCCTCACCTCCCTCGCCGACTTCAAC
CGCCAAGTCGTAAAATCAGACACGGCAACCGTCAAATTCATAGAGCTGGACCTCGAAATGCCCCCCGGCCGCGGC
CAGCTCACCAACGTCGAAGGCCTCCTCACCACCATAATCACCGACCTCGAACCAGGCCAACCAACCCGCAAAGAA
CAAACCCCCGAAATCCACGACAAAATCGCACACATCATCTCAAAAGGCCACGCCATGCTCGCAGGAACCGCCTTT
CCCTTCCGCCTCTCCATCGACGACCCAACCGGCAACTCCTTCATCTCCCCCGACCTCAAAGACGGAATAGGCAAA
TGGCAAAAACGCGAATACCCCCGCTCAGCAGATCAAAACGCCGCCCTCGGCCTCCCAGACACCGCCCCCTCCGCC
TCCCACCCCGAAACCCCCGACGAGGTCTACGACTTCCCCGCCTCATGCCCCAGCTGCGCCCACGCCTGCACAACA
AACATGAAGATGGTCGACATCCCCCACTTCAAACAAGTAATCCTCATGTCCACCCTCTGCGACTCCTGCGGCTAC
CGCTCCACCGACGTCAAAACCGGCGGCGAGATCCCCCCCAAAGGCCAACGCACAACCCTCACCGTCACCGACGCC
AAAGACCTCACCCGCGACATCCTCAAAAGCGAATCCTGCGCCCTCTCCTGCCCAGAGCTCAAGCTACACGTCAAC
CCCGGCACCCTCGGCAGCCGCTTCACAACGGTAGAGGGCCTCCTCTCCCAAGTCCGCTCCGACCTCCACAGCCAC
ATCTTCTCCGACGACGCCCCCGCCAACGACGGCAGAACAGCAGCAGACTCCCTCGCCGCAGACGACAAACAGAAC
TGGTCCTCCTTCTTCGCAACCCTCGACGCCGCCATCGCAGGCGAAACGCCCTTCACCCTCATCCTCACCGACCCC
CTATCCGCGAGCTTCATCCAACCCCTCGCCGAGCCCCCTTCCGAAGACGCGCGTCTCCGGCGAGAGGACTATGAT
CGCTCGGCGGAGGAGGAGGATGAGTTGGGGCTTAGCGATATGCGGACTGAGGGGTATGTTGAGGAGGGGGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail