Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3515
Gene name
LocationContig_311:18802..21219
Strand+
Gene length (bp)2417
Transcript length (bp)2277
Coding sequence length (bp)2277
Protein length (aa) 759

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09359 VTC VTC domain 7.1E-98 198 471
PF02656 DUF202 Domain of unknown function (DUF202) 4.9E-11 653 717

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 492 0.0E+00
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 750 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 748 3.0E-97
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 491 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 491 7.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 492 0.0E+00
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 750 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 748 3.0E-97
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 491 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 491 7.0E-67
sp|Q9UR17|VTC1_SCHPO Vacuolar transporter chaperone 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrf1 PE=2 SV=1 633 750 5.0E-30
sp|P40046|VTC1_YEAST Vacuolar transporter chaperone 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC1 PE=1 SV=3 640 750 2.0E-25
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 627 748 5.0E-21
sp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 1 OS=Arabidopsis thaliana GN=SPX1 PE=2 SV=2 1 171 3.0E-07
sp|O48781|SPX2_ARATH SPX domain-containing protein 2 OS=Arabidopsis thaliana GN=SPX2 PE=2 SV=1 43 192 6.0E-07
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 1 140 7.0E-07
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 100 158 8.0E-07
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 1 140 8.0E-07
sp|Q7Y0F6|SPX5_ORYSJ SPX domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=SPX5 PE=2 SV=1 1 169 1.0E-06
sp|A2XHU0|SPX5_ORYSI SPX domain-containing protein 5 OS=Oryza sativa subsp. indica GN=SPX5 PE=3 SV=1 1 169 1.0E-06
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 1 140 3.0E-06
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 1 140 3.0E-06
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 1 140 3.0E-06
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 1 140 4.0E-06
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 1 140 4.0E-06
sp|Q7XEY9|SPX3_ORYSJ SPX domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=SPX3 PE=2 SV=1 1 169 7.0E-06
sp|A2Z6W1|SPX3_ORYSI SPX domain-containing protein 3 OS=Oryza sativa subsp. indica GN=SPX3 PE=3 SV=1 1 169 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 689 711 22
2 731 750 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3515
MKFGEQLRSSVIREYQWYYIDYNGLKAELKTARAGGREWTEDDETRFVGKLEDELEKVHTKQQVKAMEISRRIAV
SEREVRDVVGRLDHRALGDQGPCEEEFVLLEEDLGDIIAEVHDLAKFVQLNYTGFYKIIKKHDKMTGWHLRPAFD
TRLKAKPFYKENYDTSVIKLSTLYDLVRTRGNPVQGDSAAGGSQASFVRQTTKYWVHPDNVTELKLIILKHLPVL
VFNAAKAFEQQDSAITSIYFDNPDTWDLYEGRLKKTEGAEAIRLRWYGGMKTETVFVERKTHREDWTGEKSVKAR
FSVKEKNVNAYLRGELLPAALFDKARREGRKPEKAIAEDERLASEIQYAVLKRGYRPVCRSFYNRTAFQLPADAR
VRISLDTELTMMREDNLDGRRRCGDNWRRMDIGIDYPFAQLPPDDVVRFPYAVLEVKLQTQLGQEPPAWVRQLIS
SHLVEAVPKFSKFIHGAACLFPDRIHLLPFWMPQMDVDIRKPVTHDFGIRRRPGTAGTTTSSEDEEEDLDSDDGA
GHDDHDGPRQQPANDDAERQTADDAHQDDADFPIYDSDDEYDENYELDEARRLGGRRYYSALVAAKARSLGRGAL
SVVKAVAPRPRPSRIPQSQRQRQLFGPGAVVEQRRFRAPPGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYVGAI
AVTLLNFGTRTSSLSFWSAAAFTLLALLSLAYSVVVYLYRSRAIRSRRAARYYDRWGPSVLCGALFVAVAVNFVL
EGRQRGLL*
Coding >Ophun1|3515
ATGAAGTTCGGCGAGCAGCTGCGCTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAGAGCCGGCGGTCGCGAATGGACCGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATTTCCCGCCGCATCGCCGTC
AGTGAGCGCGAGGTTCGCGACGTCGTCGGCCGCCTCGACCATCGCGCGTTGGGCGATCAGGGGCCCTGCGAGGAG
GAGTTTGTCCTGCTCGAGGAGGACCTGGGCGACATCATAGCCGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACGGGATTCTATAAGATAATCAAGAAGCACGACAAAATGACGGGTTGGCACCTCCGGCCCGCCTTCGAC
ACCCGCCTCAAGGCAAAGCCCTTTTACAAGGAAAACTACGACACCTCCGTCATCAAGCTCTCGACCCTCTACGAC
CTCGTCCGCACCCGCGGCAACCCCGTCCAGGGCGACAGCGCCGCCGGCGGCTCCCAGGCCAGCTTCGTCAGGCAG
ACGACCAAGTACTGGGTCCATCCCGACAACGTCACCGAGCTCAAGCTCATCATCCTCAAGCACCTCCCCGTCCTC
GTCTTCAACGCGGCCAAGGCCTTTGAGCAGCAGGACTCGGCCATCACCTCCATCTACTTTGACAACCCGGACACG
TGGGACCTGTACGAGGGCCGCCTCAAGAAGACCGAGGGCGCAGAGGCCATCCGCCTGCGCTGGTACGGCGGCATG
AAGACCGAGACCGTCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGC
TTCTCCGTCAAGGAGAAGAACGTCAACGCCTACCTGCGCGGCGAGCTGCTGCCGGCCGCCCTCTTCGACAAGGCC
CGCAGGGAGGGCCGCAAGCCGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCTTCCGAGATCCAGTACGCCGTG
CTCAAGAGGGGCTACCGGCCCGTCTGCCGCTCCTTTTACAACCGGACCGCCTTCCAGCTGCCGGCCGACGCCCGA
GTCCGCATCTCGCTCGATACCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCGGCGACGCTGCGGCGAC
AACTGGCGCCGAATGGACATTGGCATCGACTATCCCTTTGCCCAGCTGCCGCCTGACGATGTCGTCCGCTTCCCG
TACGCCGTGCTCGAGGTCAAGCTGCAGACGCAGCTGGGACAGGAGCCGCCCGCGTGGGTGCGTCAGCTCATCTCG
TCTCACCTCGTCGAGGCCGTTCCCAAGTTCTCCAAGTTCATCCACGGCGCCGCCTGTCTGTTCCCGGACCGCATC
CATCTGCTGCCCTTTTGGATGCCCCAGATGGACGTCGACATCCGCAAGCCCGTCACCCACGACTTTGGCATCCGT
CGGAGGCCGGGCACCGCCGGAACAACCACGTCGTCCGAGGACGAGGAGGAGGACCTGGACTCGGATGACGGCGCT
GGCCACGACGACCATGACGGCCCTCGACAGCAGCCGGCCAACGACGACGCCGAGCGTCAGACGGCCGATGACGCC
CACCAAGACGACGCAGACTTCCCCATCTACGACTCGGACGACGAGTACGACGAGAACTACGAGCTCGACGAGGCC
CGACGCCTGGGCGGTCGTCGCTACTACTCGGCCCTCGTCGCGGCCAAGGCCCGTTCCCTCGGCCGAGGCGCCCTC
TCCGTCGTAAAGGCCGTCGCTCCCCGTCCGCGGCCTTCGCGGATCCCGCAGTCGCAGCGGCAGCGGCAGCTCTTC
GGCCCCGGCGCCGTCGTCGAGCAGCGGCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGTCCGGGTC
GAGCCCAAGGTCTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAATACTCCATCTACGTAGGCGCCATC
GCCGTCACCCTCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTTCTGGTCGGCCGCCGCCTTCACCCTGCTG
GCGCTGCTGAGCCTGGCCTACTCGGTCGTCGTCTACCTGTACCGGAGCCGGGCGATTCGGAGCCGGCGGGCGGCG
CGGTACTACGATCGCTGGGGGCCTTCGGTCCTGTGCGGCGCGCTGTTTGTGGCTGTTGCTGTGAATTTCGTGCTC
GAGGGGAGGCAGAGGGGGTTGTTGTGA
Transcript >Ophun1|3515
ATGAAGTTCGGCGAGCAGCTGCGCTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAGAGCCGGCGGTCGCGAATGGACCGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATTTCCCGCCGCATCGCCGTC
AGTGAGCGCGAGGTTCGCGACGTCGTCGGCCGCCTCGACCATCGCGCGTTGGGCGATCAGGGGCCCTGCGAGGAG
GAGTTTGTCCTGCTCGAGGAGGACCTGGGCGACATCATAGCCGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACGGGATTCTATAAGATAATCAAGAAGCACGACAAAATGACGGGTTGGCACCTCCGGCCCGCCTTCGAC
ACCCGCCTCAAGGCAAAGCCCTTTTACAAGGAAAACTACGACACCTCCGTCATCAAGCTCTCGACCCTCTACGAC
CTCGTCCGCACCCGCGGCAACCCCGTCCAGGGCGACAGCGCCGCCGGCGGCTCCCAGGCCAGCTTCGTCAGGCAG
ACGACCAAGTACTGGGTCCATCCCGACAACGTCACCGAGCTCAAGCTCATCATCCTCAAGCACCTCCCCGTCCTC
GTCTTCAACGCGGCCAAGGCCTTTGAGCAGCAGGACTCGGCCATCACCTCCATCTACTTTGACAACCCGGACACG
TGGGACCTGTACGAGGGCCGCCTCAAGAAGACCGAGGGCGCAGAGGCCATCCGCCTGCGCTGGTACGGCGGCATG
AAGACCGAGACCGTCTTCGTCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGC
TTCTCCGTCAAGGAGAAGAACGTCAACGCCTACCTGCGCGGCGAGCTGCTGCCGGCCGCCCTCTTCGACAAGGCC
CGCAGGGAGGGCCGCAAGCCGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCTTCCGAGATCCAGTACGCCGTG
CTCAAGAGGGGCTACCGGCCCGTCTGCCGCTCCTTTTACAACCGGACCGCCTTCCAGCTGCCGGCCGACGCCCGA
GTCCGCATCTCGCTCGATACCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCGGCGACGCTGCGGCGAC
AACTGGCGCCGAATGGACATTGGCATCGACTATCCCTTTGCCCAGCTGCCGCCTGACGATGTCGTCCGCTTCCCG
TACGCCGTGCTCGAGGTCAAGCTGCAGACGCAGCTGGGACAGGAGCCGCCCGCGTGGGTGCGTCAGCTCATCTCG
TCTCACCTCGTCGAGGCCGTTCCCAAGTTCTCCAAGTTCATCCACGGCGCCGCCTGTCTGTTCCCGGACCGCATC
CATCTGCTGCCCTTTTGGATGCCCCAGATGGACGTCGACATCCGCAAGCCCGTCACCCACGACTTTGGCATCCGT
CGGAGGCCGGGCACCGCCGGAACAACCACGTCGTCCGAGGACGAGGAGGAGGACCTGGACTCGGATGACGGCGCT
GGCCACGACGACCATGACGGCCCTCGACAGCAGCCGGCCAACGACGACGCCGAGCGTCAGACGGCCGATGACGCC
CACCAAGACGACGCAGACTTCCCCATCTACGACTCGGACGACGAGTACGACGAGAACTACGAGCTCGACGAGGCC
CGACGCCTGGGCGGTCGTCGCTACTACTCGGCCCTCGTCGCGGCCAAGGCCCGTTCCCTCGGCCGAGGCGCCCTC
TCCGTCGTAAAGGCCGTCGCTCCCCGTCCGCGGCCTTCGCGGATCCCGCAGTCGCAGCGGCAGCGGCAGCTCTTC
GGCCCCGGCGCCGTCGTCGAGCAGCGGCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGTCCGGGTC
GAGCCCAAGGTCTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAATACTCCATCTACGTAGGCGCCATC
GCCGTCACCCTCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTTCTGGTCGGCCGCCGCCTTCACCCTGCTG
GCGCTGCTGAGCCTGGCCTACTCGGTCGTCGTCTACCTGTACCGGAGCCGGGCGATTCGGAGCCGGCGGGCGGCG
CGGTACTACGATCGCTGGGGGCCTTCGGTCCTGTGCGGCGCGCTGTTTGTGGCTGTTGCTGTGAATTTCGTGCTC
GAGGGGAGGCAGAGGGGGTTGTTGTGA
Gene >Ophun1|3515
ATGAAGTTCGGCGAGCAGCTGCGCTCCAGCGTCATCCGCGAGTATCAATGGTACTACATCGACTACAACGGCCTC
AAGGCCGAGCTCAAGACGGCCAGAGCCGGCGGTCGCGAATGGACCGAGGACGACGAGACGCGCTTCGTCGGCAAG
CTCGAGGACGAGCTGGAAAAGGTGCACACCAAGCAGCAGGTCAAGGCCATGGAGATTTCCCGCCGCATCGCCGTC
AGTGAGCGCGAGGTTCGCGACGTCGTCGGCCGCCTCGACCATCGCGCGTTGGGCGATCAGGGGCCCTGCGAGGAG
GAGTTTGTCCTGCTCGAGGAGGACCTGGGCGACATCATAGCCGAGGTCCACGACCTGGCCAAGTTTGTCCAGCTC
AACTATACGGGATTCTATAAGATAATCAAGAAGCACGACGTGAGCTTTCCTTTTTGCCTTGTTCCTCTTCCTCTT
CCTCTAACGACAGACAACAGAAAATGACGGGTTGGCACCTCCGGCCCGCCTTCGACACCCGCCTCAAGGCAAAGC
CCTTTTACAAGGAAAACTACGACACCTCCGTCATCAAGCTCTCGACCCTCTACGACCTCGTCCGCACCCGCGGCA
ACCCCGTCCAGGGCGACAGCGCCGCCGGCGGCTCCCAGGCCAGCTTCGTCAGGCAGACGACCAAGTACTGGGTCC
ATCCCGACAACGTCACCGAGCTCAAGCTCATCATCCTCAAGCACCTCCCCGTCCTCGTCTTCAACGCGGCCAAGG
CCTTTGAGCAGCAGGACTCGGCCATCACCTCCATCTACTTTGACAACCCGGACACGTGGGACCTGTACGAGGGCC
GCCTCAAGAAGACCGAGGGCGCAGAGGCCATCCGCCTGCGCTGGTACGGCGGCATGAAGACCGAGACCGTCTTCG
TCGAGCGCAAGACGCACCGCGAGGACTGGACCGGCGAGAAGTCGGTCAAGGCCCGCTTCTCCGTCAAGGAGAAGA
ACGTCAACGCCTACCTGCGCGGCGAGCTGCTGCCGGCCGCCCTCTTCGACAAGGCCCGCAGGGAGGGCCGCAAGC
CGGAAAAGGCCATTGCCGAGGACGAGAGGCTGGCTTCCGAGATCCAGTACGCCGTGCTCAAGAGGGGCTACCGGC
CCGTCTGCCGCTCCTTTTACAACCGGACCGCCTTCCAGCTGCCGGCCGACGCCCGAGTCCGCATCTCGCTCGATA
CCGAGCTGACCATGATGCGAGAGGACAACCTCGACGGCCGGCGACGCTGCGGCGACAACTGGCGCCGAATGGACA
TTGGCATCGACTATCCCTTTGCCCAGCTGCCGCCTGACGATGTCGTCCGCTTCCCGTACGCCGTGCTCGAGGTCA
AGCTGCAGACGCAGCTGGGACAGGAGCCGCCCGCGTGGGTGCGTCAGCTCATCTCGTCTCACCTCGTCGAGGCCG
TTCCCAAGTTCTCCAAGTTCATCCACGGCGCCGCCTGTCTGTTCCCGGACCGCATCCATCTGCTGCCCTTTTGGA
TGCCCCAGATGGACGTCGACATCCGCAAGCCCGTCACCCACGACTTTGGCATCCGTCGGAGGCCGGGCACCGCCG
GAACAACCACGTCGTCCGAGGACGAGGAGGAGGACCTGGACTCGGATGACGGCGCTGGCCACGACGACCATGACG
GCCCTCGACAGCAGCCGGCCAACGACGACGCCGAGCGTCAGACGGCCGATGACGCCCACCAAGACGACGCAGACT
TCCCCATCTACGACTCGGACGACGAGTACGACGAGAACTACGAGCTCGACGAGGCCCGACGCCTGGGCGGTCGTC
GCTACTACTCGGCCCTCGTCGCGGCCAAGGCCCGTTCCCTCGGCCGAGGCGCCCTCTCCGTCGTAAAGGCCGTCG
CTCCCCGTCCGCGGCCTTCGCGGATCCCGCAGTCGCAGCGGCAGCGGCAGCTCTTCGGCCCCGGCGCCGTCGTCG
AGCAGCGGCGCTTCCGGGCGCCTCCGGGCAAGAAGATTTACGTGCCGGTCCGGGTCGAGCCCAAGGTCTACTTTG
CCGCCGAGCGGACCTTTCTCGGATGGGTGAGTGTTTCCTCTCCTTTCCTTGAACCCCCATCCCGTCGTTCAGGTA
TCAAGAGGGAAGCGACTGACGGGCATATCCCCCAGCTCGAATACTCCATCTACGTAGGCGCCATCGCCGTCACCC
TCCTCAACTTCGGCACCCGCACCTCGTCCCTCTCCTTCTGGTCGGCCGCCGCCTTCACCCTGCTGGCGCTGCTGA
GCCTGGCCTACTCGGTCGTCGTCTACCTGTACCGGAGCCGGGCGATTCGGAGCCGGCGGGCGGCGCGGTACTACG
ATCGCTGGGGGCCTTCGGTCCTGTGCGGCGCGCTGTTTGTGGCTGTTGCTGTGAATTTCGTGCTCGAGGGGAGGC
AGAGGGGGTTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail