Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3505
Gene name
LocationContig_310:18868..20454
Strand-
Gene length (bp)1586
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-12 44 125
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-10 235 308
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-10 9 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 123 3.0E-08
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 58 136 2.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 60 129 3.0E-07
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 248 319 3.0E-07
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 7 123 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 123 3.0E-08
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 58 136 2.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 60 129 3.0E-07
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 248 319 3.0E-07
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 7 123 1.0E-06
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 44 129 6.0E-06
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 39 125 8.0E-06
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 42 123 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 63 19
3 76 98 22
4 204 226 22
5 245 267 22
6 272 294 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3505
MSTLPLLTLLLSLAASTWGTSTGVFPAILTTLTLNLTPRLRATLTAAYYLGTLTAHLLLAAPLTDRLGRKRAAVT
GTLTISLGAVVIACAGGTGGVVLGRLVEGLGAGVVSSVVPLYAAEVAPAKDFGSELRVCPVKVKTMMQTGGSSPS
SQSSQQSSLQQLSSPGPLSRHAGFCRNTATLFAGAAEMTAKLPMTAVEMWAIDALGRRFCLLAGCLVMSVALLLS
IKETAHRIQIFPTPFRARGLNWAASGGALGSLVVSFVWPIGIAHLGSAVYFIFMALTLVCLPIIYFFYPETTGRP
LENMEVLFARQTSPLLEPHDAFDEDAPLLSM*
Coding >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GACTTTGGATCGGAGCTGCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCC
TCCCAGTCCTCCCAGCAATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGT
CGAAACACCGCGACCCTCTTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGG
GCCATCGACGCTCTGGGTCGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTACTCAGC
ATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGGGCTGCTTCC
GGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGCGCCGTCTAC
TTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCT
TTGGAGAACATGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGAT
GCCCCCCTTCTTTCAATGTGA
Transcript >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GACTTTGGATCGGAGCTGCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCC
TCCCAGTCCTCCCAGCAATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGT
CGAAACACCGCGACCCTCTTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGG
GCCATCGACGCTCTGGGTCGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTACTCAGC
ATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGGGCTGCTTCC
GGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGCGCCGTCTAC
TTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCT
TTGGAGAACATGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGAT
GCCCCCCTTCTTTCAATGTGA
Gene >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GTGAGGGGGGCGGTTATTGCCGGTAGTCATGCTGGGTTTGTTGCTGGTGTTGCGGTAGGACTTTGGATCGGAGCT
GCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCCTCCCAGTCCTCCCAGCA
ATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGTCGAAACACCGCGAGTCT
GAAGCAAGGGGAGCTCTCCTCTGGCTTCGACGCCCAGCCGATGACACAGCCATCACCGACCTGAGCATCAATACT
AATATAAACGTCTCGGCTTCAATCCTTCGGCCGTTACTCCTTCGCGCCTTTACCCTTCAACTCCTCTCTCAACTC
TGCGGCGCTACGACTGCGAAATACTACCTGCCTCAACTCCTTCGAGCCCTCGGCATCTCACCTCGTGCAGCCCTC
TTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGGGCCATCGACGCTCTGGGT
CGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTAGTACGTCCTCGTCTTCTTGTTAAA
GTCATCATCCTGAGAAGACGTCGTCTCCTGTTCCTTCACTGCCATAGACTTACTAGTTGAACGTATAGATCAACG
GCGCCCTCCCACTCGCATATCCGCACAATGCAAATCCAATCGCCGACACCATCTGCGTAGCCTTCATTTTCGTCT
ATGCCCTCGGCTACAGTCTTGGTCTCGGTCCCGCTTCCTGGGTCTACAGCTCCGAAGTCTCTCCCCCTACTTCTC
CAGCTCAGCATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGG
GCTGCTTCCGGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGC
GCCGTCTACTTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGGTAAGACGACGACTTGTTGCCCTCGATACG
ATTCTTCTAATCACTTTCGGTCCAAGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCTTTGGAGAACA
TGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGATGCCCCCCTTC
TTTCAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail