Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3505
Gene name
LocationContig_310:18868..20454
Strand-
Gene length (bp)1586
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-12 44 125
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-10 235 308
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-10 9 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 123 3.0E-08
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 58 136 2.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 60 129 3.0E-07
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 248 319 3.0E-07
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 7 123 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 58 123 3.0E-08
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 58 136 2.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 60 129 3.0E-07
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 248 319 3.0E-07
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 7 123 1.0E-06
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 44 129 6.0E-06
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 39 125 8.0E-06
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 42 123 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 63 19
3 76 98 22
4 204 226 22
5 245 267 22
6 272 294 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup217
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5923
Ophiocordyceps australis 1348a (Ghana) OphauG2|5924
Ophiocordyceps australis 1348a (Ghana) OphauG2|5925
Ophiocordyceps australis map64 (Brazil) OphauB2|6674
Ophiocordyceps australis map64 (Brazil) OphauB2|6675
Ophiocordyceps camponoti-rufipedis Ophun1|3505 (this protein)
Ophiocordyceps kimflemingae Ophio5|2122
Ophiocordyceps subramaniannii Hirsu2|2200
Ophiocordyceps subramaniannii Hirsu2|5685
Ophiocordyceps subramaniannii Hirsu2|9032

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3505
MSTLPLLTLLLSLAASTWGTSTGVFPAILTTLTLNLTPRLRATLTAAYYLGTLTAHLLLAAPLTDRLGRKRAAVT
GTLTISLGAVVIACAGGTGGVVLGRLVEGLGAGVVSSVVPLYAAEVAPAKDFGSELRVCPVKVKTMMQTGGSSPS
SQSSQQSSLQQLSSPGPLSRHAGFCRNTATLFAGAAEMTAKLPMTAVEMWAIDALGRRFCLLAGCLVMSVALLLS
IKETAHRIQIFPTPFRARGLNWAASGGALGSLVVSFVWPIGIAHLGSAVYFIFMALTLVCLPIIYFFYPETTGRP
LENMEVLFARQTSPLLEPHDAFDEDAPLLSM*
Coding >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GACTTTGGATCGGAGCTGCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCC
TCCCAGTCCTCCCAGCAATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGT
CGAAACACCGCGACCCTCTTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGG
GCCATCGACGCTCTGGGTCGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTACTCAGC
ATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGGGCTGCTTCC
GGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGCGCCGTCTAC
TTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCT
TTGGAGAACATGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGAT
GCCCCCCTTCTTTCAATGTGA
Transcript >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GACTTTGGATCGGAGCTGCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCC
TCCCAGTCCTCCCAGCAATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGT
CGAAACACCGCGACCCTCTTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGG
GCCATCGACGCTCTGGGTCGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTACTCAGC
ATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGGGCTGCTTCC
GGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGCGCCGTCTAC
TTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCT
TTGGAGAACATGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGAT
GCCCCCCTTCTTTCAATGTGA
Gene >Ophun1|3505
ATGTCAACCCTCCCCCTCCTAACCCTCCTCCTCTCCCTCGCCGCCTCAACATGGGGCACCTCAACCGGCGTCTTC
CCCGCCATCCTCACAACCCTCACCCTCAATCTCACCCCCCGCCTCCGCGCCACCCTCACAGCAGCCTATTACCTC
GGCACTCTGACAGCCCACCTCCTCCTCGCCGCCCCTCTCACCGACCGTCTCGGCCGCAAACGCGCCGCCGTCACC
GGCACGCTGACCATCTCCCTCGGTGCTGTCGTCATAGCCTGCGCGGGGGGGACGGGCGGTGTTGTGCTGGGGAGG
TTGGTTGAGGGGCTTGGGGCGGGCGTTGTCAGTTCGGTTGTGCCGCTTTATGCTGCTGAGGTTGCGCCTGCAAAG
GTGAGGGGGGCGGTTATTGCCGGTAGTCATGCTGGGTTTGTTGCTGGTGTTGCGGTAGGACTTTGGATCGGAGCT
GCGAGTGTGTCCCGTCAAGGTGAAGACGATGATGCAAACTGGCGGCTCCTCGCCCTCCTCCCAGTCCTCCCAGCA
ATCATCTTTACAGCAATTGTCCTCCCCTGGGCCCCTGAGTCGCCACGCTGGCTTCTGTCGAAACACCGCGAGTCT
GAAGCAAGGGGAGCTCTCCTCTGGCTTCGACGCCCAGCCGATGACACAGCCATCACCGACCTGAGCATCAATACT
AATATAAACGTCTCGGCTTCAATCCTTCGGCCGTTACTCCTTCGCGCCTTTACCCTTCAACTCCTCTCTCAACTC
TGCGGCGCTACGACTGCGAAATACTACCTGCCTCAACTCCTTCGAGCCCTCGGCATCTCACCTCGTGCAGCCCTC
TTTGCCGGCGCGGCGGAGATGACGGCTAAGCTTCCGATGACGGCCGTTGAGATGTGGGCCATCGACGCTCTGGGT
CGTAGATTCTGTCTTCTCGCTGGGTGTCTCGTCATGTCCGTGGCCTTGTTAGTACGTCCTCGTCTTCTTGTTAAA
GTCATCATCCTGAGAAGACGTCGTCTCCTGTTCCTTCACTGCCATAGACTTACTAGTTGAACGTATAGATCAACG
GCGCCCTCCCACTCGCATATCCGCACAATGCAAATCCAATCGCCGACACCATCTGCGTAGCCTTCATTTTCGTCT
ATGCCCTCGGCTACAGTCTTGGTCTCGGTCCCGCTTCCTGGGTCTACAGCTCCGAAGTCTCTCCCCCTACTTCTC
CAGCTCAGCATCAAGGAAACTGCTCACCGTATTCAGATCTTTCCAACCCCCTTCCGAGCCCGGGGCCTCAACTGG
GCTGCTTCCGGAGGTGCCCTCGGCAGCCTCGTCGTCTCCTTTGTCTGGCCCATTGGCATCGCCCACCTCGGTAGC
GCCGTCTACTTTATCTTTATGGCCTTGACCCTGGTCTGTCTGCCGGTAAGACGACGACTTGTTGCCCTCGATACG
ATTCTTCTAATCACTTTCGGTCCAAGATTATCTACTTCTTCTATCCCGAAACCACCGGCCGCCCTTTGGAGAACA
TGGAGGTCCTCTTCGCCCGTCAGACATCCCCGTTGTTGGAGCCGCATGACGCCTTCGATGAAGATGCCCCCCTTC
TTTCAATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail