Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3504
Gene name
LocationContig_310:11168..18723
Strand+
Gene length (bp)7555
Transcript length (bp)7341
Coding sequence length (bp)7341
Protein length (aa) 2447

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02259 FAT FAT domain 7.1E-129 1379 1796
PF11865 DUF3385 Domain of unknown function (DUF3385) 1.6E-73 738 898
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 6.0E-74 2071 2319
PF08771 FRB_dom FKBP12-rapamycin binding domain 1.8E-45 1904 2001
PF02985 HEAT HEAT repeat 1.4E-03 704 734
PF02260 FATC FATC domain 2.8E-13 2416 2446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 1 2446 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 28 2446 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 24 2446 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 12 2446 0.0E+00
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 261 2446 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 1 2446 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 28 2446 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 24 2446 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 12 2446 0.0E+00
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 261 2446 0.0E+00
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 18 2446 0.0E+00
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 261 2446 0.0E+00
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 28 2446 0.0E+00
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 32 2446 0.0E+00
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 261 2446 0.0E+00
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 261 1724 0.0E+00
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 1768 2446 0.0E+00
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 1729 2446 0.0E+00
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 15 1072 3.0E-81
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 1116 1724 3.0E-72
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 1791 2324 2.0E-66
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 1791 2351 4.0E-61
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 1791 2351 5.0E-61
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 1791 2328 8.0E-57
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 1791 2328 7.0E-55
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 2042 2349 6.0E-50
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 2025 2442 2.0E-49
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 2042 2316 3.0E-49
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 2004 2352 3.0E-49
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 2025 2442 2.0E-48
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 2042 2445 8.0E-48
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 1758 2322 7.0E-47
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 2039 2442 8.0E-47
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 2017 2445 3.0E-46
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 2042 2442 5.0E-45
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 1997 2325 6.0E-45
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 1997 2325 7.0E-45
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 2035 2325 2.0E-44
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 2030 2340 5.0E-44
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 2042 2445 2.0E-43
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 2066 2446 6.0E-43
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 1809 2319 2.0E-42
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 2058 2442 1.0E-41
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 1844 2319 2.0E-41
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 2039 2445 3.0E-41
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 2039 2445 4.0E-41
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 2024 2445 4.0E-40
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 2023 2313 5.0E-40
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 2040 2313 5.0E-40
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 2039 2445 2.0E-39
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 2039 2323 2.0E-39
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 2058 2446 3.0E-39
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 2040 2323 3.0E-39
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 2058 2446 4.0E-38
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 2027 2318 4.0E-38
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 2032 2313 6.0E-38
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 2058 2446 7.0E-38
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 2058 2446 4.0E-37
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1844 2319 2.0E-36
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 2031 2445 5.0E-35
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 1827 2319 6.0E-35
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 1844 2319 7.0E-35
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 2058 2446 2.0E-34
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 2051 2326 2.0E-33
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 12 260 3.0E-33
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 12 260 8.0E-33
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 12 260 9.0E-33
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 2173 2325 1.0E-30
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 1990 2318 4.0E-30
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 1990 2318 4.0E-30
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 2042 2363 3.0E-23
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 1990 2341 3.0E-23
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 1772 2148 1.0E-20
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 12 266 8.0E-20
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 1238 1889 9.0E-17
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 1915 2318 2.0E-12
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 1245 1548 7.0E-12
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 1245 1548 7.0E-12
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 1823 2329 1.0E-10
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 2050 2299 3.0E-10
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 2026 2332 1.0E-09
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 2050 2299 4.0E-09
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 2052 2297 1.0E-08
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 2074 2342 3.0E-08
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 2072 2316 4.0E-08
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 2193 2297 4.0E-08
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 2193 2297 4.0E-08
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 2051 2270 5.0E-08
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 2051 2270 5.0E-08
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 2021 2308 5.0E-08
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 2051 2270 6.0E-08
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 1993 2329 7.0E-08
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 2072 2308 2.0E-07
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 2197 2286 5.0E-07
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 1662 1880 1.0E-06
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 1318 1536 1.0E-06
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 2081 2308 2.0E-06
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 2093 2308 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044877 protein-containing complex binding Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4373
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4332
Ophiocordyceps australis map64 (Brazil) OphauB2|4561
Ophiocordyceps camponoti-floridani Ophcf2|01647
Ophiocordyceps camponoti-rufipedis Ophun1|3504 (this protein)
Ophiocordyceps kimflemingae Ophio5|6563
Ophiocordyceps subramaniannii Hirsu2|9033

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3504
MAQQQQVALERLEHIARGLRSRIGDDIRKRAALQLRELVAVCHRDLSQEQFLAFYNVVNNRITQLITHGSDSAER
LGGIFALDALVDFDGVDVAAKYTRFTQNLKTILRGKDINPMQPAAIALGKLCRPGGSLISELVESEVNTALEWLQ
NDRVEERRYSAVLVLRELARNAPTLMYQFIPTIFDWIWIGLRDPRKLIRATSAETVSACFRIIRERDQEMRQLWM
SKIYNEARQGLKINTVESIHASLLVLKELLEQGGMFMQEHYQEACDIVFKHKDHRDPTIRSTVVLLIPDLASYSP
ADFAHGWLHKFMVYLSGMLKKDKERNDAFLAIGNIANSVKSAIAPYLDGVLIYVREGLSVNSRKRGSVDPVFDCI
SRLAVAVGQTLSKYMEALLDPIFACDLTPKLTQALVDMAFYIPPVKPTIQERLLDMLSVVLCGEPFKPLGAPQPN
TLNSVPALAKDAKDPQAYEHRRAEVKLALNTLGSFDFSGHILNEFVRDVAIKYVEDEDPEIREAAALTCCQLYVR
DPIVNQTSYHALQVVGDVIEKLLTVGVSDPEPSIRRTVLAALDERFDRHLAKAENIRILFFALNDEIFAIREVAI
SIIGRLARYNPAYVIPSLRKTLIQMLTELEFSDVARNKEESAKLLSLLVQNAQTLIKPYVEPMISVLLPKASDPL
PSVAATILKAIGELATVGGEDMLPYKDRLMPLIIDALQDQSSNMKREAALNALGHLASNSGYVIEPYLEYPQLLE
ILQGIIRTEGQRGPLRQETIKLMGILGALDPYKHQQVEERIPEVQRRVESNQMTDISLMMTGLTPSNKEYFPTVV
INALLQILKDHSLAQHHAAVIEAIMNIFRTLGLECVSFLDRIVPAFLHVIRSSASTRLESYFNQLATLVSIVRQH
IRNYLHDIIEILQEYWHKSGSLQTTIISLVEAISRSLEGEFKIYLAGILPLMLGVLDKDLSTKRIPSERVLHAFL
VFGASAEEYMHLIIPVIVRTFEKQGQPAFIRKQAIDTIGKISRQVNLNDYAAKIIHPLTRVLDMGEPQLRVAALD
TLCALIQQLGKDYLHFMGTVNKVMTMHQIQHQNYELLVSKLKKGEVLPQDLSSQPRFTDMADDTPLADLGTKKLE
MNPVHLKAAWDTRGKSTKEDWQEWLRRFSTTLLTESPNHALRACASLASVYLPLARELFNSAFVSCWSELYEQFQ
DELIQNIESAIKSENVPPDLLGLLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHYKELEFLQDQSSGAV
EALIVINNQLQQSDAAIGILRKAQLYKEGIQLRETWFEKLERWEEALAFYNKREREVAADQPVPIEIVMGKMRCL
HALGEWDALANLTGSTWANSAPEVQRMIAPLATAAAWGQCKWDSMDNYLSSLKRHSPDRSFFGAILALHRNQFRE
AISCVEQAREGLDTELSALVSESYNRAYQVVVRVQMLAELEELIVYKQCDEKKQATMRKTWETRLQGCQRNVEVW
HRMLRLRALVLSPVENMRMWIKFANLCRKSGRMGLAEKSLKQLIGSDAALETMIPYWPESISERTGASAAAARSI
PAQVTYAVLKFEWELGQQPMTRREGVAERTLYCLQRFTNDAAHRLDVAKAHLSAQTGGDMNLVTADYGFQHQVDP
ALVSPQTQRALYDQTVLLAKCYLRQGEWLKALYKDDWQCSKVQEILTSYSQATKYNPRWYKAWHAWALANFEIVQ
TLSSSSSSSSSSSSQASSLSSTTRSHAEGGQLSRADQAMVIEHVVPAIHGFFKSIALSAGSSLQDTLRLLTLWFT
HGGSSEVNAAVMDGMANVSIDTWLEVIPQLIARINQPNKRVQQSVHNLLADVGRTHPQALVYPLTVAMKSGPNTR
RSRSAAQIMDSMRQHSVNLVAQADTVSHELIRVAVLWHELWHEGLEEASRLYFGDHNIDGMFATLEPLHELLERG
PETLREISFAQAFGRDLKEAQEWCHQYETTKDVNELNQAWDLYYQVFRRISRQLPQVTTLELTYCSPKLLAARDL
DLAVPGTYRSGQPVVKIRSFDSTFSVINSKQRPRKLNVNGSDGVSYAFLLKGHEDIRQDERVMQLFGLCNTLLAN
DSECYKRHLNIQRYPAIPLSQNSGLLGWVPNSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEV
FGYALDNTTGQDLYRVLWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKIIHIDFGDC
FEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCEHVMRVLRENKESVMAVLEAFIHDPLLTWRLTNAAS
PAGPNFQSEREAARARRHSILDADVAPSELLANGEPSGPPRTRARTNSSVVPDGNGVNGQETESQNARAVEVLDR
VSQKLTGRDFKTPDELDVINQVNKLIVEATKLENLCQHYIGWCSFW*
Coding >Ophun1|3504
ATGGCGCAGCAGCAGCAGGTGGCGCTGGAGCGCCTGGAACACATCGCGAGAGGCCTACGGTCCCGGATTGGAGAT
GACATTCGAAAGCGAGCGGCGTTGCAGCTGCGGGAGCTCGTTGCCGTGTGCCATCGCGACCTCAGCCAGGAGCAG
TTCCTCGCCTTCTACAACGTTGTCAACAACAGGATCACTCAACTCATCACACATGGCAGCGACTCTGCCGAGCGA
CTAGGCGGCATCTTTGCCCTCGACGCCCTCGTCGATTTTGACGGTGTCGATGTCGCCGCCAAATACACCCGTTTC
ACGCAGAACCTCAAGACGATTCTACGTGGCAAGGACATAAACCCAATGCAGCCCGCGGCCATCGCGCTGGGGAAG
CTATGTCGGCCCGGCGGCTCCCTCATCTCCGAGCTTGTCGAGTCCGAGGTCAACACGGCGCTTGAGTGGCTTCAG
AACGACCGCGTCGAGGAACGCAGATACAGCGCGGTTCTCGTCCTCCGAGAGCTTGCCAGAAATGCTCCGACTCTC
ATGTATCAGTTCATCCCCACCATCTTTGACTGGATCTGGATAGGGCTGCGAGACCCTCGGAAGTTGATTCGCGCC
ACCTCGGCCGAGACTGTCAGCGCTTGCTTCCGTATCATTCGCGAGAGAGATCAGGAAATGAGGCAGCTGTGGATG
AGCAAGATCTACAACGAGGCCCGGCAGGGTCTCAAGATCAACACAGTCGAGTCCATTCACGCCTCACTGCTCGTA
CTCAAGGAGCTCCTTGAGCAAGGAGGCATGTTTATGCAGGAGCACTATCAGGAGGCCTGCGACATTGTCTTCAAG
CACAAGGACCATCGCGACCCGACCATTCGGAGCACCGTCGTGCTTCTTATCCCAGACTTGGCCAGCTACTCGCCA
GCTGACTTTGCCCACGGCTGGCTGCACAAGTTCATGGTCTATTTGTCCGGCATGCTAAAGAAGGACAAGGAGCGT
AACGACGCCTTTCTGGCCATCGGCAACATCGCCAACTCGGTCAAGAGCGCCATAGCCCCTTATCTCGACGGCGTT
CTCATCTACGTCAGAGAGGGGCTAAGCGTCAACTCCCGCAAGAGAGGTTCGGTCGACCCCGTCTTCGACTGCATC
AGCCGTCTCGCCGTCGCCGTCGGTCAGACGTTGAGCAAGTACATGGAGGCGCTGCTCGATCCCATCTTTGCATGC
GACTTGACGCCCAAGCTCACACAGGCCCTCGTGGATATGGCCTTTTACATACCACCCGTCAAGCCCACCATCCAG
GAGAGGCTGCTCGACATGCTGAGCGTCGTCCTCTGCGGAGAACCCTTCAAGCCGCTGGGCGCCCCGCAGCCCAAC
ACGCTCAACTCGGTGCCTGCCTTGGCCAAGGACGCCAAGGATCCTCAGGCCTACGAGCACCGGCGGGCCGAGGTC
AAGCTCGCGCTTAATACCCTGGGCAGCTTCGACTTCTCCGGTCACATTCTAAACGAGTTCGTGCGGGACGTGGCC
ATCAAATACGTCGAGGACGAGGATCCGGAGATCAGAGAGGCGGCCGCCCTCACCTGCTGTCAGCTATATGTCAGG
GACCCCATCGTCAATCAGACGAGTTATCATGCCCTACAGGTCGTGGGGGACGTCATCGAGAAACTTCTCACGGTG
GGCGTGTCGGATCCGGAGCCGAGCATCCGCCGGACTGTCCTGGCTGCTCTCGATGAACGTTTTGATCGTCACCTG
GCCAAGGCTGAAAACATTCGCATCCTCTTTTTTGCCCTCAACGACGAGATCTTCGCCATTAGAGAGGTAGCCATA
TCCATCATCGGCCGGCTGGCCAGGTACAATCCGGCCTACGTCATTCCGTCCCTGAGGAAGACGCTCATCCAGATG
CTCACCGAGCTGGAGTTTTCCGATGTCGCCCGCAACAAGGAAGAGAGCGCCAAACTATTGAGCCTCCTGGTGCAG
AACGCGCAGACGCTTATCAAGCCCTACGTGGAGCCCATGATCTCAGTCCTCCTGCCCAAGGCGAGCGACCCCTTG
CCTTCGGTGGCCGCAACGATCCTCAAGGCCATTGGCGAACTGGCCACCGTCGGAGGCGAAGACATGCTCCCGTAC
AAAGACCGCCTGATGCCCCTCATCATCGACGCGCTTCAAGATCAGAGCTCCAACATGAAGCGCGAGGCTGCCCTA
AACGCCTTGGGTCACCTCGCTAGCAACTCGGGATACGTCATCGAGCCCTACCTCGAGTACCCCCAGCTCCTGGAG
ATTTTGCAGGGCATCATCAGGACGGAGGGTCAGAGGGGCCCTTTGCGACAGGAGACGATCAAGCTGATGGGAATA
TTGGGCGCCTTGGACCCTTACAAGCACCAGCAAGTTGAGGAGCGGATACCAGAGGTACAGCGACGAGTCGAGTCT
AATCAGATGACCGATATCTCGCTCATGATGACGGGCTTGACGCCGTCCAACAAGGAATACTTCCCTACCGTCGTC
ATCAACGCGCTGCTGCAAATTCTCAAGGACCATTCGTTGGCGCAGCACCACGCCGCAGTGATTGAAGCCATCATG
AACATCTTCCGGACGCTCGGCCTCGAGTGTGTCTCTTTTCTCGATCGCATTGTCCCGGCGTTCCTTCACGTCATC
CGATCGTCGGCTTCGACGCGGCTCGAGTCGTACTTTAACCAGCTGGCAACTTTGGTGAGCATCGTGCGACAACAT
ATTAGGAATTACCTCCACGACATCATCGAGATTCTCCAGGAGTACTGGCACAAGTCGGGATCGCTGCAGACGACC
ATCATATCGCTGGTCGAAGCCATTTCCCGCTCCCTCGAGGGCGAGTTCAAGATCTACCTGGCTGGCATCCTGCCC
CTTATGCTTGGTGTCCTCGACAAGGACCTGAGCACCAAGAGAATTCCCTCGGAGCGGGTGCTGCATGCCTTTCTG
GTCTTTGGCGCGAGTGCTGAAGAGTACATGCACCTCATCATCCCCGTCATTGTCCGCACTTTCGAGAAGCAGGGC
CAGCCGGCCTTCATCCGCAAGCAGGCCATCGATACCATCGGCAAGATCTCGCGCCAGGTCAACCTGAACGACTAC
GCGGCCAAGATCATCCACCCGCTCACCCGAGTTCTAGACATGGGCGAGCCCCAGCTGCGGGTGGCGGCGCTGGAC
ACGCTCTGCGCTCTGATACAGCAGCTCGGGAAGGATTACCTCCATTTCATGGGCACGGTCAACAAGGTGATGACC
ATGCATCAGATACAGCACCAGAACTACGAGCTCCTCGTGAGCAAGCTGAAAAAGGGCGAGGTGCTGCCGCAGGAC
CTCAGCTCGCAGCCGCGGTTCACTGACATGGCGGACGACACGCCGCTGGCCGACCTGGGCACCAAGAAGCTCGAG
ATGAACCCTGTCCACCTCAAGGCCGCCTGGGACACACGGGGCAAATCCACCAAGGAGGACTGGCAGGAGTGGCTA
CGGCGCTTCAGCACGACGCTGCTGACCGAGTCGCCGAACCATGCGCTGCGTGCCTGCGCCAGCCTGGCCAGCGTC
TACCTGCCGCTGGCGCGGGAGCTGTTCAACTCTGCCTTTGTCTCGTGCTGGAGCGAGCTGTACGAGCAATTCCAG
GACGAGCTCATCCAGAACATTGAGAGCGCCATCAAGTCGGAAAATGTACCGCCGGACCTGCTCGGCCTGCTGCTG
AACCTGGCCGAATTCATGGAGCACGACGACAAGGCGCTGCCCATCGACATCCGCGTGCTGGGGAGGGAGGCGGCC
CGATGCCACGCGTACGCCAAGGCTCTCCATTACAAGGAACTCGAGTTTCTGCAGGACCAGAGCAGCGGCGCGGTG
GAGGCGCTCATCGTCATCAATAACCAGCTGCAACAGTCGGACGCCGCTATTGGTATCCTCCGAAAGGCGCAGCTG
TACAAGGAGGGCATCCAGCTGCGCGAGACGTGGTTCGAGAAGCTCGAGAGATGGGAGGAGGCTCTTGCATTCTAC
AACAAGCGTGAGCGCGAGGTGGCAGCGGACCAGCCGGTGCCCATCGAGATCGTCATGGGCAAGATGCGATGCCTG
CACGCGCTCGGCGAGTGGGACGCGCTGGCCAACCTGACGGGCAGCACATGGGCCAACTCGGCGCCCGAAGTGCAG
CGGATGATTGCGCCTCTGGCGACGGCGGCGGCCTGGGGCCAGTGCAAATGGGACTCGATGGATAACTACCTATCG
TCGCTCAAGCGTCACTCGCCGGACAGGTCCTTCTTCGGCGCCATCCTCGCCCTGCACCGCAACCAGTTCCGCGAG
GCCATCTCGTGCGTCGAGCAGGCGCGCGAGGGCCTCGACACGGAGCTCAGCGCGCTGGTGAGCGAGTCGTACAAC
AGGGCTTACCAGGTGGTGGTGCGGGTGCAGATGCTGGCCGAGCTGGAGGAGCTCATCGTCTACAAGCAATGCGAT
GAGAAGAAGCAGGCGACGATGCGCAAGACGTGGGAGACGAGACTGCAGGGATGCCAGCGCAACGTCGAGGTCTGG
CACCGGATGCTCCGGCTGAGAGCTCTGGTTCTCTCGCCCGTCGAGAATATGCGGATGTGGATCAAGTTCGCCAAC
CTCTGCCGCAAGTCGGGCCGGATGGGGCTGGCGGAAAAGTCGCTGAAGCAGCTGATCGGTTCGGACGCGGCGCTC
GAGACCATGATACCCTACTGGCCCGAGAGCATCAGCGAGCGGACGGGGGCGTCGGCGGCAGCGGCGCGGAGCATC
CCGGCGCAGGTGACGTACGCCGTGCTCAAGTTCGAGTGGGAGCTGGGCCAGCAGCCGATGACACGGCGCGAGGGC
GTGGCGGAGAGGACGCTATACTGCCTGCAGCGCTTCACCAACGACGCGGCGCACCGGCTGGACGTGGCCAAGGCA
CACCTTTCGGCGCAGACGGGCGGCGACATGAACCTGGTGACGGCCGACTACGGCTTCCAGCACCAGGTCGACCCG
GCTCTGGTGAGCCCGCAGACGCAGCGGGCGCTCTACGACCAGACGGTGCTGCTGGCCAAGTGCTACCTCCGCCAG
GGCGAGTGGCTCAAGGCGCTCTACAAGGACGACTGGCAGTGCAGCAAGGTGCAGGAGATCCTGACGTCGTACTCG
CAGGCGACCAAGTACAACCCGCGCTGGTACAAGGCCTGGCACGCGTGGGCGCTGGCCAACTTTGAGATTGTCCAG
ACGCTGTCGTCGTCTTCGTCATCGTCGTCTTCGTCTTCGTCTCAGGCGTCTTCGCTGTCGTCGACGACGCGGTCG
CACGCCGAGGGCGGCCAGCTCTCTCGAGCAGACCAGGCCATGGTCATCGAGCACGTGGTGCCGGCCATCCACGGC
TTCTTCAAGTCGATCGCCCTGTCGGCCGGCAGCTCGCTCCAGGACACGCTCCGGCTGCTGACTCTCTGGTTCACG
CACGGCGGCAGCTCCGAGGTCAACGCGGCCGTCATGGACGGCATGGCCAACGTCAGCATCGACACTTGGCTCGAG
GTTATACCGCAGCTGATTGCGCGCATCAACCAGCCTAACAAGCGGGTGCAGCAGTCGGTTCACAACCTCCTGGCC
GACGTCGGACGGACGCACCCGCAGGCGCTCGTCTATCCCCTGACGGTGGCCATGAAGTCTGGGCCCAACACGCGG
CGGTCGCGGTCGGCGGCGCAGATCATGGACAGCATGAGGCAGCACAGCGTCAACCTGGTGGCTCAGGCCGACACG
GTAAGCCACGAGCTGATTCGCGTCGCCGTCCTCTGGCACGAGCTCTGGCACGAGGGGCTAGAGGAGGCATCGCGC
CTCTACTTTGGCGATCACAACATCGATGGCATGTTTGCCACGCTGGAACCGCTGCACGAACTGCTGGAGCGCGGG
CCGGAGACTCTTCGCGAGATCTCGTTTGCGCAGGCCTTCGGACGCGACCTTAAGGAGGCGCAGGAGTGGTGCCAC
CAGTACGAGACGACCAAGGACGTCAACGAGCTCAACCAGGCCTGGGATCTCTACTACCAGGTCTTCCGGCGCATC
TCTCGGCAGCTCCCGCAGGTGACGACGCTGGAACTGACGTACTGCTCGCCCAAGCTGCTGGCGGCGCGGGACCTG
GACCTGGCGGTGCCGGGCACGTACCGCAGCGGGCAGCCCGTCGTCAAGATCCGGTCCTTTGACTCGACCTTTAGC
GTCATCAACTCGAAGCAGCGGCCGCGGAAGCTCAACGTCAATGGCAGCGATGGCGTCTCGTACGCCTTTTTGCTC
AAGGGCCACGAGGATATCAGGCAGGACGAGAGGGTGATGCAGCTGTTTGGGCTCTGCAACACGCTTCTAGCCAAC
GACTCGGAGTGCTACAAGCGGCACCTCAACATCCAGCGGTATCCTGCCATCCCGCTGTCTCAGAATTCGGGCCTG
CTGGGCTGGGTGCCCAACAGCGACACGCTGCACGTGCTGATCCGCGAGTACCGCGAGAGCCGCAAGATCCTGCTC
AACATTGAGCATCGCATCATGCTCCAGATGGCGCCCGACTACGACAACCTGACGCTGATGCAAAAGGTCGAGGTG
TTTGGGTACGCGCTCGACAACACGACGGGTCAGGACCTGTACCGGGTGCTGTGGCTCAAGAGCAAGTCGTCGGAA
GCCTGGTTGGAACGTCGGACCAACTACACGCGGTCGCTGGGCGTCATGTCCATGGTTGGCTACATCCTCGGGCTG
GGGGATCGACACCCGTCGAACCTGATGCTGGACCGCATCACGGGCAAGATTATCCACATCGACTTTGGCGACTGC
TTCGAGGTGGCCATGAAGCGCGAAAAGTACCCGGAGCGGGTTCCGTTCCGACTGACACGCATGTTGACGTACGCC
ATGGAGGTGAGCAACATCGAGGGCAGCTTCCGGATAACGTGTGAGCACGTGATGCGGGTGCTGCGGGAGAATAAG
GAGAGCGTCATGGCGGTGCTTGAAGCGTTCATCCACGACCCCCTCCTGACGTGGCGGCTGACCAATGCGGCATCG
CCGGCCGGGCCCAACTTCCAGTCGGAGCGGGAGGCGGCGCGGGCTCGACGACACTCGATCCTGGACGCCGACGTG
GCGCCTTCGGAGCTGCTAGCTAACGGCGAACCGTCCGGGCCGCCGCGGACACGGGCCCGGACTAACAGCTCGGTC
GTGCCGGACGGGAACGGAGTCAACGGGCAGGAGACTGAGAGCCAGAACGCGAGGGCGGTCGAAGTGCTGGACCGG
GTTTCGCAGAAGCTTACGGGTCGGGATTTCAAGACGCCCGACGAGCTCGACGTGATCAATCAGGTTAACAAGCTG
ATTGTGGAAGCGACGAAGCTGGAGAATCTCTGCCAGCATTACATTGGCTGGTGTAGCTTCTGGTGA
Transcript >Ophun1|3504
ATGGCGCAGCAGCAGCAGGTGGCGCTGGAGCGCCTGGAACACATCGCGAGAGGCCTACGGTCCCGGATTGGAGAT
GACATTCGAAAGCGAGCGGCGTTGCAGCTGCGGGAGCTCGTTGCCGTGTGCCATCGCGACCTCAGCCAGGAGCAG
TTCCTCGCCTTCTACAACGTTGTCAACAACAGGATCACTCAACTCATCACACATGGCAGCGACTCTGCCGAGCGA
CTAGGCGGCATCTTTGCCCTCGACGCCCTCGTCGATTTTGACGGTGTCGATGTCGCCGCCAAATACACCCGTTTC
ACGCAGAACCTCAAGACGATTCTACGTGGCAAGGACATAAACCCAATGCAGCCCGCGGCCATCGCGCTGGGGAAG
CTATGTCGGCCCGGCGGCTCCCTCATCTCCGAGCTTGTCGAGTCCGAGGTCAACACGGCGCTTGAGTGGCTTCAG
AACGACCGCGTCGAGGAACGCAGATACAGCGCGGTTCTCGTCCTCCGAGAGCTTGCCAGAAATGCTCCGACTCTC
ATGTATCAGTTCATCCCCACCATCTTTGACTGGATCTGGATAGGGCTGCGAGACCCTCGGAAGTTGATTCGCGCC
ACCTCGGCCGAGACTGTCAGCGCTTGCTTCCGTATCATTCGCGAGAGAGATCAGGAAATGAGGCAGCTGTGGATG
AGCAAGATCTACAACGAGGCCCGGCAGGGTCTCAAGATCAACACAGTCGAGTCCATTCACGCCTCACTGCTCGTA
CTCAAGGAGCTCCTTGAGCAAGGAGGCATGTTTATGCAGGAGCACTATCAGGAGGCCTGCGACATTGTCTTCAAG
CACAAGGACCATCGCGACCCGACCATTCGGAGCACCGTCGTGCTTCTTATCCCAGACTTGGCCAGCTACTCGCCA
GCTGACTTTGCCCACGGCTGGCTGCACAAGTTCATGGTCTATTTGTCCGGCATGCTAAAGAAGGACAAGGAGCGT
AACGACGCCTTTCTGGCCATCGGCAACATCGCCAACTCGGTCAAGAGCGCCATAGCCCCTTATCTCGACGGCGTT
CTCATCTACGTCAGAGAGGGGCTAAGCGTCAACTCCCGCAAGAGAGGTTCGGTCGACCCCGTCTTCGACTGCATC
AGCCGTCTCGCCGTCGCCGTCGGTCAGACGTTGAGCAAGTACATGGAGGCGCTGCTCGATCCCATCTTTGCATGC
GACTTGACGCCCAAGCTCACACAGGCCCTCGTGGATATGGCCTTTTACATACCACCCGTCAAGCCCACCATCCAG
GAGAGGCTGCTCGACATGCTGAGCGTCGTCCTCTGCGGAGAACCCTTCAAGCCGCTGGGCGCCCCGCAGCCCAAC
ACGCTCAACTCGGTGCCTGCCTTGGCCAAGGACGCCAAGGATCCTCAGGCCTACGAGCACCGGCGGGCCGAGGTC
AAGCTCGCGCTTAATACCCTGGGCAGCTTCGACTTCTCCGGTCACATTCTAAACGAGTTCGTGCGGGACGTGGCC
ATCAAATACGTCGAGGACGAGGATCCGGAGATCAGAGAGGCGGCCGCCCTCACCTGCTGTCAGCTATATGTCAGG
GACCCCATCGTCAATCAGACGAGTTATCATGCCCTACAGGTCGTGGGGGACGTCATCGAGAAACTTCTCACGGTG
GGCGTGTCGGATCCGGAGCCGAGCATCCGCCGGACTGTCCTGGCTGCTCTCGATGAACGTTTTGATCGTCACCTG
GCCAAGGCTGAAAACATTCGCATCCTCTTTTTTGCCCTCAACGACGAGATCTTCGCCATTAGAGAGGTAGCCATA
TCCATCATCGGCCGGCTGGCCAGGTACAATCCGGCCTACGTCATTCCGTCCCTGAGGAAGACGCTCATCCAGATG
CTCACCGAGCTGGAGTTTTCCGATGTCGCCCGCAACAAGGAAGAGAGCGCCAAACTATTGAGCCTCCTGGTGCAG
AACGCGCAGACGCTTATCAAGCCCTACGTGGAGCCCATGATCTCAGTCCTCCTGCCCAAGGCGAGCGACCCCTTG
CCTTCGGTGGCCGCAACGATCCTCAAGGCCATTGGCGAACTGGCCACCGTCGGAGGCGAAGACATGCTCCCGTAC
AAAGACCGCCTGATGCCCCTCATCATCGACGCGCTTCAAGATCAGAGCTCCAACATGAAGCGCGAGGCTGCCCTA
AACGCCTTGGGTCACCTCGCTAGCAACTCGGGATACGTCATCGAGCCCTACCTCGAGTACCCCCAGCTCCTGGAG
ATTTTGCAGGGCATCATCAGGACGGAGGGTCAGAGGGGCCCTTTGCGACAGGAGACGATCAAGCTGATGGGAATA
TTGGGCGCCTTGGACCCTTACAAGCACCAGCAAGTTGAGGAGCGGATACCAGAGGTACAGCGACGAGTCGAGTCT
AATCAGATGACCGATATCTCGCTCATGATGACGGGCTTGACGCCGTCCAACAAGGAATACTTCCCTACCGTCGTC
ATCAACGCGCTGCTGCAAATTCTCAAGGACCATTCGTTGGCGCAGCACCACGCCGCAGTGATTGAAGCCATCATG
AACATCTTCCGGACGCTCGGCCTCGAGTGTGTCTCTTTTCTCGATCGCATTGTCCCGGCGTTCCTTCACGTCATC
CGATCGTCGGCTTCGACGCGGCTCGAGTCGTACTTTAACCAGCTGGCAACTTTGGTGAGCATCGTGCGACAACAT
ATTAGGAATTACCTCCACGACATCATCGAGATTCTCCAGGAGTACTGGCACAAGTCGGGATCGCTGCAGACGACC
ATCATATCGCTGGTCGAAGCCATTTCCCGCTCCCTCGAGGGCGAGTTCAAGATCTACCTGGCTGGCATCCTGCCC
CTTATGCTTGGTGTCCTCGACAAGGACCTGAGCACCAAGAGAATTCCCTCGGAGCGGGTGCTGCATGCCTTTCTG
GTCTTTGGCGCGAGTGCTGAAGAGTACATGCACCTCATCATCCCCGTCATTGTCCGCACTTTCGAGAAGCAGGGC
CAGCCGGCCTTCATCCGCAAGCAGGCCATCGATACCATCGGCAAGATCTCGCGCCAGGTCAACCTGAACGACTAC
GCGGCCAAGATCATCCACCCGCTCACCCGAGTTCTAGACATGGGCGAGCCCCAGCTGCGGGTGGCGGCGCTGGAC
ACGCTCTGCGCTCTGATACAGCAGCTCGGGAAGGATTACCTCCATTTCATGGGCACGGTCAACAAGGTGATGACC
ATGCATCAGATACAGCACCAGAACTACGAGCTCCTCGTGAGCAAGCTGAAAAAGGGCGAGGTGCTGCCGCAGGAC
CTCAGCTCGCAGCCGCGGTTCACTGACATGGCGGACGACACGCCGCTGGCCGACCTGGGCACCAAGAAGCTCGAG
ATGAACCCTGTCCACCTCAAGGCCGCCTGGGACACACGGGGCAAATCCACCAAGGAGGACTGGCAGGAGTGGCTA
CGGCGCTTCAGCACGACGCTGCTGACCGAGTCGCCGAACCATGCGCTGCGTGCCTGCGCCAGCCTGGCCAGCGTC
TACCTGCCGCTGGCGCGGGAGCTGTTCAACTCTGCCTTTGTCTCGTGCTGGAGCGAGCTGTACGAGCAATTCCAG
GACGAGCTCATCCAGAACATTGAGAGCGCCATCAAGTCGGAAAATGTACCGCCGGACCTGCTCGGCCTGCTGCTG
AACCTGGCCGAATTCATGGAGCACGACGACAAGGCGCTGCCCATCGACATCCGCGTGCTGGGGAGGGAGGCGGCC
CGATGCCACGCGTACGCCAAGGCTCTCCATTACAAGGAACTCGAGTTTCTGCAGGACCAGAGCAGCGGCGCGGTG
GAGGCGCTCATCGTCATCAATAACCAGCTGCAACAGTCGGACGCCGCTATTGGTATCCTCCGAAAGGCGCAGCTG
TACAAGGAGGGCATCCAGCTGCGCGAGACGTGGTTCGAGAAGCTCGAGAGATGGGAGGAGGCTCTTGCATTCTAC
AACAAGCGTGAGCGCGAGGTGGCAGCGGACCAGCCGGTGCCCATCGAGATCGTCATGGGCAAGATGCGATGCCTG
CACGCGCTCGGCGAGTGGGACGCGCTGGCCAACCTGACGGGCAGCACATGGGCCAACTCGGCGCCCGAAGTGCAG
CGGATGATTGCGCCTCTGGCGACGGCGGCGGCCTGGGGCCAGTGCAAATGGGACTCGATGGATAACTACCTATCG
TCGCTCAAGCGTCACTCGCCGGACAGGTCCTTCTTCGGCGCCATCCTCGCCCTGCACCGCAACCAGTTCCGCGAG
GCCATCTCGTGCGTCGAGCAGGCGCGCGAGGGCCTCGACACGGAGCTCAGCGCGCTGGTGAGCGAGTCGTACAAC
AGGGCTTACCAGGTGGTGGTGCGGGTGCAGATGCTGGCCGAGCTGGAGGAGCTCATCGTCTACAAGCAATGCGAT
GAGAAGAAGCAGGCGACGATGCGCAAGACGTGGGAGACGAGACTGCAGGGATGCCAGCGCAACGTCGAGGTCTGG
CACCGGATGCTCCGGCTGAGAGCTCTGGTTCTCTCGCCCGTCGAGAATATGCGGATGTGGATCAAGTTCGCCAAC
CTCTGCCGCAAGTCGGGCCGGATGGGGCTGGCGGAAAAGTCGCTGAAGCAGCTGATCGGTTCGGACGCGGCGCTC
GAGACCATGATACCCTACTGGCCCGAGAGCATCAGCGAGCGGACGGGGGCGTCGGCGGCAGCGGCGCGGAGCATC
CCGGCGCAGGTGACGTACGCCGTGCTCAAGTTCGAGTGGGAGCTGGGCCAGCAGCCGATGACACGGCGCGAGGGC
GTGGCGGAGAGGACGCTATACTGCCTGCAGCGCTTCACCAACGACGCGGCGCACCGGCTGGACGTGGCCAAGGCA
CACCTTTCGGCGCAGACGGGCGGCGACATGAACCTGGTGACGGCCGACTACGGCTTCCAGCACCAGGTCGACCCG
GCTCTGGTGAGCCCGCAGACGCAGCGGGCGCTCTACGACCAGACGGTGCTGCTGGCCAAGTGCTACCTCCGCCAG
GGCGAGTGGCTCAAGGCGCTCTACAAGGACGACTGGCAGTGCAGCAAGGTGCAGGAGATCCTGACGTCGTACTCG
CAGGCGACCAAGTACAACCCGCGCTGGTACAAGGCCTGGCACGCGTGGGCGCTGGCCAACTTTGAGATTGTCCAG
ACGCTGTCGTCGTCTTCGTCATCGTCGTCTTCGTCTTCGTCTCAGGCGTCTTCGCTGTCGTCGACGACGCGGTCG
CACGCCGAGGGCGGCCAGCTCTCTCGAGCAGACCAGGCCATGGTCATCGAGCACGTGGTGCCGGCCATCCACGGC
TTCTTCAAGTCGATCGCCCTGTCGGCCGGCAGCTCGCTCCAGGACACGCTCCGGCTGCTGACTCTCTGGTTCACG
CACGGCGGCAGCTCCGAGGTCAACGCGGCCGTCATGGACGGCATGGCCAACGTCAGCATCGACACTTGGCTCGAG
GTTATACCGCAGCTGATTGCGCGCATCAACCAGCCTAACAAGCGGGTGCAGCAGTCGGTTCACAACCTCCTGGCC
GACGTCGGACGGACGCACCCGCAGGCGCTCGTCTATCCCCTGACGGTGGCCATGAAGTCTGGGCCCAACACGCGG
CGGTCGCGGTCGGCGGCGCAGATCATGGACAGCATGAGGCAGCACAGCGTCAACCTGGTGGCTCAGGCCGACACG
GTAAGCCACGAGCTGATTCGCGTCGCCGTCCTCTGGCACGAGCTCTGGCACGAGGGGCTAGAGGAGGCATCGCGC
CTCTACTTTGGCGATCACAACATCGATGGCATGTTTGCCACGCTGGAACCGCTGCACGAACTGCTGGAGCGCGGG
CCGGAGACTCTTCGCGAGATCTCGTTTGCGCAGGCCTTCGGACGCGACCTTAAGGAGGCGCAGGAGTGGTGCCAC
CAGTACGAGACGACCAAGGACGTCAACGAGCTCAACCAGGCCTGGGATCTCTACTACCAGGTCTTCCGGCGCATC
TCTCGGCAGCTCCCGCAGGTGACGACGCTGGAACTGACGTACTGCTCGCCCAAGCTGCTGGCGGCGCGGGACCTG
GACCTGGCGGTGCCGGGCACGTACCGCAGCGGGCAGCCCGTCGTCAAGATCCGGTCCTTTGACTCGACCTTTAGC
GTCATCAACTCGAAGCAGCGGCCGCGGAAGCTCAACGTCAATGGCAGCGATGGCGTCTCGTACGCCTTTTTGCTC
AAGGGCCACGAGGATATCAGGCAGGACGAGAGGGTGATGCAGCTGTTTGGGCTCTGCAACACGCTTCTAGCCAAC
GACTCGGAGTGCTACAAGCGGCACCTCAACATCCAGCGGTATCCTGCCATCCCGCTGTCTCAGAATTCGGGCCTG
CTGGGCTGGGTGCCCAACAGCGACACGCTGCACGTGCTGATCCGCGAGTACCGCGAGAGCCGCAAGATCCTGCTC
AACATTGAGCATCGCATCATGCTCCAGATGGCGCCCGACTACGACAACCTGACGCTGATGCAAAAGGTCGAGGTG
TTTGGGTACGCGCTCGACAACACGACGGGTCAGGACCTGTACCGGGTGCTGTGGCTCAAGAGCAAGTCGTCGGAA
GCCTGGTTGGAACGTCGGACCAACTACACGCGGTCGCTGGGCGTCATGTCCATGGTTGGCTACATCCTCGGGCTG
GGGGATCGACACCCGTCGAACCTGATGCTGGACCGCATCACGGGCAAGATTATCCACATCGACTTTGGCGACTGC
TTCGAGGTGGCCATGAAGCGCGAAAAGTACCCGGAGCGGGTTCCGTTCCGACTGACACGCATGTTGACGTACGCC
ATGGAGGTGAGCAACATCGAGGGCAGCTTCCGGATAACGTGTGAGCACGTGATGCGGGTGCTGCGGGAGAATAAG
GAGAGCGTCATGGCGGTGCTTGAAGCGTTCATCCACGACCCCCTCCTGACGTGGCGGCTGACCAATGCGGCATCG
CCGGCCGGGCCCAACTTCCAGTCGGAGCGGGAGGCGGCGCGGGCTCGACGACACTCGATCCTGGACGCCGACGTG
GCGCCTTCGGAGCTGCTAGCTAACGGCGAACCGTCCGGGCCGCCGCGGACACGGGCCCGGACTAACAGCTCGGTC
GTGCCGGACGGGAACGGAGTCAACGGGCAGGAGACTGAGAGCCAGAACGCGAGGGCGGTCGAAGTGCTGGACCGG
GTTTCGCAGAAGCTTACGGGTCGGGATTTCAAGACGCCCGACGAGCTCGACGTGATCAATCAGGTTAACAAGCTG
ATTGTGGAAGCGACGAAGCTGGAGAATCTCTGCCAGCATTACATTGGCTGGTGTAGCTTCTGGTGA
Gene >Ophun1|3504
ATGGCGCAGCAGCAGCAGGTGGCGCTGGAGCGCCTGGAACACATCGCGAGAGGCCTACGGTCCCGGTAAGCCTAC
TGCCCTGCTGCATTTGAAATATCCTGACCATCTTTCAGGATTGGAGATGACATTCGAAAGCGAGCGGCGTTGCAG
CTGCGGGAGCTCGTTGCCGTGTGCCATCGCGGTAAGGACCATCTTCTGTTATTCGACCCGAGTTTCGCGTTGACA
ATTACTCGACAGACCTCAGCCAGGAGCAGTTCCTCGCCTTCTACAACGTTGTCAACAACAGGATCACTCAACTCA
TCACACATGGCAGCGACTCTGCCGAGCGACTAGGCGGCATCTTTGCCCTCGACGCCCTCGTCGATTTTGACGGTG
TCGATGTCGCCGCCAAATACACCCGTTTCACGCAGAACCTCAAGACGATTCTACGTGGCAAGGACATAAACCCAA
TGCAGCCCGCGGCCATCGCGCTGGGGAAGCTATGTCGGCCCGGCGGCTCCCTCATCTCCGAGCTTGTCGAGTCCG
AGGTCAACACGGCGCTTGAGTGGCTTCAGAACGACCGCGTCGAGGAACGCAGATACAGCGCGGTTCTCGTCCTCC
GAGAGCTTGCCAGAAATGCTCCGACTCTCATGTATCAGTTCATCCCCACCATCTTTGACTGGATCTGGATAGGGC
TGCGAGACCCTCGGAAGTTGATTCGCGCCACCTCGGCCGAGACTGTCAGCGCTTGCTTCCGTATCATTCGCGAGA
GAGATCAGGAAATGAGGCAGCTGTGGATGAGCAAGATCTACAACGAGGCCCGGCAGGGTCTCAAGATCAACACAG
TCGAGTCCATTCACGCCTCACTGCTCGTACTCAAGGAGCTCCTTGAGCAAGGAGGCATGTTTATGCAGGAGCACT
ATCAGGAGGCCTGCGACATTGTCTTCAAGCACAAGGACCATCGCGACCCGACCATTCGGAGCACCGTCGTGCTTC
TTATCCCAGACTTGGCCAGCTACTCGCCAGCTGACTTTGCCCACGGCTGGCTGCACAAGTTCATGGTCTATTTGT
CCGGCATGCTAAAGAAGGACAAGGAGCGTAACGACGCCTTTCTGGCCATCGGCAACATCGCCAACTCGGTCAAGA
GCGCCATAGCCCCTTATCTCGACGGCGTTCTCATCTACGTCAGAGAGGGGCTAAGCGTCAACTCCCGCAAGAGAG
GTTCGGTCGACCCCGTCTTCGACTGCATCAGCCGTCTCGCCGTCGCCGTCGGTCAGACGTTGAGCAAGTACATGG
AGGCGCTGCTCGATCCCATCTTTGCATGCGACTTGACGCCCAAGCTCACACAGGCCCTCGTGGATATGGCCTTTT
ACATACCACCCGTCAAGCCCACCATCCAGGAGAGGCTGCTCGACATGCTGAGCGTCGTCCTCTGCGGAGAACCCT
TCAAGCCGCTGGGCGCCCCGCAGCCCAACACGCTCAACTCGGTGCCTGCCTTGGCCAAGGACGCCAAGGATCCTC
AGGCCTACGAGCACCGGCGGGCCGAGGTCAAGCTCGCGCTTAATACCCTGGGCAGCTTCGACTTCTCCGGTCACA
TTCTAAACGAGTTCGTGCGGGACGTGGCCATCAAATACGTCGAGGACGAGGATCCGGAGATCAGAGAGGCGGCCG
CCCTCACCTGCTGTCAGCTATATGTCAGGGACCCCATCGTCAATCAGACGAGTTATCATGCCCTACAGGTCGTGG
GGGACGTCATCGAGAAACTTCTCACGGTGGGCGTGTCGGATCCGGAGCCGAGCATCCGCCGGACTGTCCTGGCTG
CTCTCGATGAACGTTTTGATCGTCACCTGGCCAAGGCTGAAAACATTCGCATCCTCTTTTTTGCCCTCAACGACG
AGATCTTCGCCATTAGAGAGGTAGCCATATCCATCATCGGCCGGCTGGCCAGGTACAATCCGGCCTACGTCATTC
CGTCCCTGAGGAAGACGCTCATCCAGATGCTCACCGAGCTGGAGTTTTCCGATGTCGCCCGCAACAAGGAAGAGA
GCGCCAAACTATTGAGCCTCCTGGTGCAGAACGCGCAGACGCTTATCAAGCCCTACGTGGAGCCCATGATCTCAG
TCCTCCTGCCCAAGGCGAGCGACCCCTTGCCTTCGGTGGCCGCAACGATCCTCAAGGCCATTGGCGAACTGGCCA
CCGTCGGAGGCGAAGACATGCTCCCGTACAAAGACCGCCTGATGCCCCTCATCATCGACGCGCTTCAAGATCAGA
GCTCCAACATGAAGCGCGAGGCTGCCCTAAACGCCTTGGGTCACCTCGCTAGCAACTCGGGATACGTCATCGAGC
CCTACCTCGAGTACCCCCAGCTCCTGGAGATTTTGCAGGGCATCATCAGGACGGAGGGTCAGAGGGGCCCTTTGC
GACAGGAGACGATCAAGCTGATGGGAATATTGGGCGCCTTGGACCCTTACAAGCACCAGGTTAGGCCAGATGCCT
CTTCTTTTCCGTCGTAGATGCTGACAAAAAGACACAGCAAGTTGAGGAGCGGATACCAGAGGTACAGCGACGAGT
CGAGTCTAATCAGATGACCGATATCTCGCTCATGATGACGGGCTTGACGCCGTCCAACAAGGAATACTTCCCTAC
CGTCGTCATCAACGCGCTGCTGCAAATTCTCAAGGACCATTCGTTGGCGCAGCACCACGCCGCAGTGATTGAAGC
CATCATGAACATCTTCCGGACGCTCGGCCTCGAGTGTGTCTCTTTTCTCGATCGCATTGTCCCGGCGTTCCTTCA
CGTCATCCGATCGTCGGCTTCGACGCGGCTCGAGTCGTACTTTAACCAGCTGGCAACTTTGGTGAGCATCGTGCG
ACAACATATTAGGAATTACCTCCACGACATCATCGAGATTCTCCAGGAGTACTGGCACAAGTCGGGATCGCTGCA
GACGACCATCATATCGCTGGTCGAAGCCATTTCCCGCTCCCTCGAGGGCGAGTTCAAGATCTACCTGGCTGGCAT
CCTGCCCCTTATGCTTGGTGTCCTCGACAAGGACCTGAGCACCAAGAGAATTCCCTCGGAGCGGGTGCTGCATGC
CTTTCTGGTCTTTGGCGCGAGTGCTGAAGAGTACATGCACCTCATCATCCCCGTCATTGTCCGCACTTTCGAGAA
GCAGGGCCAGCCGGCCTTCATCCGCAAGCAGGCCATCGATACCATCGGCAAGATCTCGCGCCAGGTCAACCTGAA
CGACTACGCGGCCAAGATCATCCACCCGCTCACCCGAGTTCTAGACATGGGCGAGCCCCAGCTGCGGGTGGCGGC
GCTGGACACGCTCTGCGCTCTGATACAGCAGCTCGGGAAGGATTACCTCCATTTCATGGGCACGGTCAACAAGGT
GATGACCATGCATCAGATACAGCACCAGAACTACGAGCTCCTCGTGAGCAAGCTGAAAAAGGGCGAGGTGCTGCC
GCAGGACCTCAGCTCGCAGCCGCGGTTCACTGACATGGCGGACGACACGCCGCTGGCCGACCTGGGCACCAAGAA
GCTCGAGATGAACCCTGTCCACCTCAAGGCCGCCTGGGACACACGGGGCAAATCCACCAAGGAGGACTGGCAGGA
GTGGCTACGGCGCTTCAGCACGACGCTGCTGACCGAGTCGCCGAACCATGCGCTGCGTGCCTGCGCCAGCCTGGC
CAGCGTCTACCTGCCGCTGGCGCGGGAGCTGTTCAACTCTGCCTTTGTCTCGTGCTGGAGCGAGCTGTACGAGCA
ATTCCAGGACGAGCTCATCCAGAACATTGAGAGCGCCATCAAGTCGGAAAATGTACCGCCGGACCTGCTCGGCCT
GCTGCTGAACCTGGCCGAATTCATGGAGCACGACGACAAGGCGCTGCCCATCGACATCCGCGTGCTGGGGAGGGA
GGCGGCCCGATGCCACGCGTACGCCAAGGCTCTCCATTACAAGGAACTCGAGTTTCTGCAGGACCAGAGCAGCGG
CGCGGTGGAGGCGCTCATCGTCATCAATAACCAGCTGCAACAGTCGGACGCCGCTATTGGTATCCTCCGAAAGGC
GCAGCTGTACAAGGAGGGCATCCAGCTGCGCGAGACGTGGTTCGAGAAGCTCGAGAGATGGGAGGAGGCTCTTGC
ATTCTACAACAAGCGTGAGCGCGAGGTGGCAGCGGACCAGCCGGTGCCCATCGAGATCGTCATGGGCAAGATGCG
ATGCCTGCACGCGCTCGGCGAGTGGGACGCGCTGGCCAACCTGACGGGCAGCACATGGGCCAACTCGGCGCCCGA
AGTGCAGCGGATGATTGCGCCTCTGGCGACGGCGGCGGCCTGGGGCCAGTGCAAATGGGACTCGATGGATAACTA
CCTATCGTCGCTCAAGCGTCACTCGCCGGACAGGTCCTTCTTCGGCGCCATCCTCGCCCTGCACCGCAACCAGTT
CCGCGAGGCCATCTCGTGCGTCGAGCAGGCGCGCGAGGGCCTCGACACGGAGCTCAGCGCGCTGGTGAGCGAGTC
GTACAACAGGGCTTACCAGGTGGTGGTGCGGGTGCAGATGCTGGCCGAGCTGGAGGAGCTCATCGTCTACAAGCA
ATGCGATGAGAAGAAGCAGGCGACGATGCGCAAGACGTGGGAGACGAGACTGCAGGGATGCCAGCGCAACGTCGA
GGTCTGGCACCGGATGCTCCGGCTGAGAGCTCTGGTTCTCTCGCCCGTCGAGAATATGCGGATGTGGATCAAGTT
CGCCAACCTCTGCCGCAAGTCGGGCCGGATGGGGCTGGCGGAAAAGTCGCTGAAGCAGCTGATCGGTTCGGACGC
GGCGCTCGAGACCATGATACCCTACTGGCCCGAGAGCATCAGCGAGCGGACGGGGGCGTCGGCGGCAGCGGCGCG
GAGCATCCCGGCGCAGGTGACGTACGCCGTGCTCAAGTTCGAGTGGGAGCTGGGCCAGCAGCCGATGACACGGCG
CGAGGGCGTGGCGGAGAGGACGCTATACTGCCTGCAGCGCTTCACCAACGACGCGGCGCACCGGCTGGACGTGGC
CAAGGCACACCTTTCGGCGCAGACGGGCGGCGACATGAACCTGGTGACGGCCGACTACGGCTTCCAGCACCAGGT
CGACCCGGCTCTGGTGAGCCCGCAGACGCAGCGGGCGCTCTACGACCAGACGGTGCTGCTGGCCAAGTGCTACCT
CCGCCAGGGCGAGTGGCTCAAGGCGCTCTACAAGGACGACTGGCAGTGCAGCAAGGTGCAGGAGATCCTGACGTC
GTACTCGCAGGCGACCAAGTACAACCCGCGCTGGTACAAGGCCTGGCACGCGTGGGCGCTGGCCAACTTTGAGAT
TGTCCAGACGCTGTCGTCGTCTTCGTCATCGTCGTCTTCGTCTTCGTCTCAGGCGTCTTCGCTGTCGTCGACGAC
GCGGTCGCACGCCGAGGGCGGCCAGCTCTCTCGAGCAGACCAGGCCATGGTCATCGAGCACGTGGTGCCGGCCAT
CCACGGCTTCTTCAAGTCGATCGCCCTGTCGGCCGGCAGCTCGCTCCAGGACACGCTCCGGCTGCTGACTCTCTG
GTTCACGCACGGCGGCAGCTCCGAGGTCAACGCGGCCGTCATGGACGGCATGGCCAACGTCAGCATCGACACTTG
GCTCGAGGTTATACCGCAGCTGATTGCGCGCATCAACCAGCCTAACAAGCGGGTGCAGCAGTCGGTTCACAACCT
CCTGGCCGACGTCGGACGGACGCACCCGCAGGCGCTCGTCTATCCCCTGACGGTGGCCATGAAGTCTGGGCCCAA
CACGCGGCGGTCGCGGTCGGCGGCGCAGATCATGGACAGCATGAGGCAGCACAGCGTCAACCTGGTGGCTCAGGC
CGACACGGTAAGCCACGAGCTGATTCGCGTCGCCGTCCTCTGGCACGAGCTCTGGCACGAGGGGCTAGAGGAGGC
ATCGCGCCTCTACTTTGGCGATCACAACATCGATGGCATGTTTGCCACGCTGGAACCGCTGCACGAACTGCTGGA
GCGCGGGCCGGAGACTCTTCGCGAGATCTCGTTTGCGCAGGCCTTCGGACGCGACCTTAAGGAGGCGCAGGAGTG
GTGCCACCAGTACGAGACGACCAAGGACGTCAACGAGCTCAACCAGGCCTGGGATCTCTACTACCAGGTCTTCCG
GCGCATCTCTCGGCAGCTCCCGCAGGTGACGACGCTGGAACTGACGTACTGCTCGCCCAAGCTGCTGGCGGCGCG
GGACCTGGACCTGGCGGTGCCGGGCACGTACCGCAGCGGGCAGCCCGTCGTCAAGATCCGGTCCTTTGACTCGAC
CTTTAGCGTCATCAACTCGAAGCAGCGGCCGCGGAAGCTCAACGTCAATGGCAGCGATGGCGTCTCGTACGCCTT
TTTGCTCAAGGGCCACGAGGATATCAGGCAGGACGAGAGGGTGATGCAGCTGTTTGGGCTCTGCAACACGCTTCT
AGCCAACGACTCGGAGTGCTACAAGCGGCACCTCAACATCCAGCGGTATCCTGCCATCCCGCTGTCTCAGAATTC
GGGCCTGCTGGGCTGGGTGCCCAACAGCGACACGCTGCACGTGCTGATCCGCGAGTACCGCGAGAGCCGCAAGAT
CCTGCTCAACATTGAGCATCGCATCATGCTCCAGATGGCGCCCGACTACGACAACCTGACGCTGATGCAAAAGGT
CGAGGTGTTTGGGTACGCGCTCGACAACACGACGGGTCAGGACCTGTACCGGGTGCTGTGGCTCAAGAGCAAGTC
GTCGGAAGCCTGGTTGGAACGTCGGACCAACTACACGCGGTCGCTGGGCGTCATGTCCATGGTTGGCTACATCCT
CGGGCTGGGGGATCGACACCCGTCGAACCTGATGCTGGACCGCATCACGGGCAAGATTATCCACATCGACTTTGG
CGACTGCTTCGAGGTGGCCATGAAGCGCGAAAAGTACCCGGAGCGGGTTCCGTTCCGACTGACACGCATGTTGAC
GTACGCCATGGAGGTGAGCAACATCGAGGGCAGCTTCCGGATAACGTGTGAGCACGTGATGCGGGTGCTGCGGGA
GAATAAGGAGAGCGTCATGGCGGTGCTTGAAGCGGTGAGTCTCTTTCTCTTTCTTATTATCTTGTACGTTGGTCA
ACTAACAGGCTTCAAGTTCATCCACGACCCCCTCCTGACGTGGCGGCTGACCAATGCGGCATCGCCGGCCGGGCC
CAACTTCCAGTCGGAGCGGGAGGCGGCGCGGGCTCGACGACACTCGATCCTGGACGCCGACGTGGCGCCTTCGGA
GCTGCTAGCTAACGGCGAACCGTCCGGGCCGCCGCGGACACGGGCCCGGACTAACAGCTCGGTCGTGCCGGACGG
GAACGGAGTCAACGGGCAGGAGACTGAGAGCCAGAACGCGAGGGCGGTCGAAGTGCTGGACCGGGTTTCGCAGAA
GCTTACGGGTCGGGATTTCAAGACGCCCGACGAGCTCGACGTGATCAATCAGGTTAACAAGCTGATTGTGGAAGC
GACGAAGCTGGAGAATCTCTGCCAGCATTACATTGGCTGGTGTAGCTTCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail