Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3500
Gene name
LocationContig_31:56847..57888
Strand-
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.9E-07 6 145

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6210
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06419
Ophiocordyceps camponoti-rufipedis Ophun1|3500 (this protein)
Ophiocordyceps kimflemingae Ophio5|6651
Ophiocordyceps subramaniannii Hirsu2|6428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3500
MATSSFQLFPLLPCELRLEVWKMAIRPAGAGVHRISLRDSSSSSSSPSVSGNTLRAVPAGDKQESRRRHIAVAEP
EASGSSASLWDAGLWTACSESRQVMMWHFRLQFWQDAGRNLLRAGGYWSPAAVADEFEDMTAMAIAWNGQADRYI
VVQPHRDLFWLEPQDWKTTVDWRTLFVDLPFSSSLRGYGHLSHIAVEFDQSWNVHLPKDLPALLKESSPRGFIAR
AMAECATNRLYSFIWLVDRHLVRDAPVQEEAMEIDTEEEAEETDQPMTFYDCRDVYVETEREDLELSRYSTQAEY
EKTAVYFLQRLGTIGNGDYALMGNDSGEPDGFEFTVDDYLGVLALV*
Coding >Ophun1|3500
ATGGCTACATCCTCCTTCCAGCTCTTCCCTCTCCTCCCCTGCGAGCTAAGGCTCGAGGTATGGAAAATGGCGATT
CGTCCGGCCGGCGCCGGCGTCCACCGGATATCCCTCCGGGACAGCAGCAGCAGCAGCAGCAGTCCGTCCGTGTCC
GGCAACACCCTACGGGCCGTCCCAGCCGGAGACAAGCAAGAGTCTCGCCGGCGGCACATTGCCGTCGCCGAGCCC
GAGGCGTCCGGATCGTCGGCCTCCCTCTGGGACGCCGGCCTGTGGACGGCCTGCAGCGAGAGCCGGCAGGTCATG
ATGTGGCACTTCAGGCTGCAGTTCTGGCAAGACGCTGGCCGGAACCTGCTGCGGGCCGGGGGTTACTGGAGTCCA
GCCGCCGTGGCGGATGAGTTTGAAGACATGACGGCCATGGCCATTGCCTGGAACGGCCAGGCTGATCGATATATC
GTGGTTCAGCCGCACCGCGACCTGTTCTGGCTGGAGCCACAGGACTGGAAGACGACGGTTGACTGGCGCACGCTC
TTTGTCGACCTCCCCTTCTCGTCTTCTCTGCGAGGCTACGGTCATCTCAGTCACATCGCCGTCGAGTTTGACCAG
AGCTGGAACGTCCATCTCCCCAAGGATCTCCCAGCCCTGCTGAAAGAGTCGAGCCCTCGAGGTTTCATCGCCCGG
GCAATGGCTGAATGTGCCACCAATCGGCTGTACTCCTTCATCTGGCTCGTCGACCGTCACCTGGTCCGAGATGCT
CCCGTACAGGAAGAGGCGATGGAGATAGATACTGAAGAAGAGGCTGAAGAGACAGACCAGCCCATGACCTTTTAC
GACTGTCGGGACGTTTACGTCGAGACGGAACGGGAGGATCTCGAGCTGAGCCGGTATTCGACTCAGGCCGAGTAC
GAGAAGACGGCTGTTTACTTTTTGCAGCGGCTGGGGACGATTGGGAATGGTGATTACGCCCTGATGGGCAATGAC
TCGGGGGAGCCGGATGGCTTCGAGTTTACCGTGGATGATTATCTCGGTGTGTTGGCGCTTGTATAG
Transcript >Ophun1|3500
ATGGCTACATCCTCCTTCCAGCTCTTCCCTCTCCTCCCCTGCGAGCTAAGGCTCGAGGTATGGAAAATGGCGATT
CGTCCGGCCGGCGCCGGCGTCCACCGGATATCCCTCCGGGACAGCAGCAGCAGCAGCAGCAGTCCGTCCGTGTCC
GGCAACACCCTACGGGCCGTCCCAGCCGGAGACAAGCAAGAGTCTCGCCGGCGGCACATTGCCGTCGCCGAGCCC
GAGGCGTCCGGATCGTCGGCCTCCCTCTGGGACGCCGGCCTGTGGACGGCCTGCAGCGAGAGCCGGCAGGTCATG
ATGTGGCACTTCAGGCTGCAGTTCTGGCAAGACGCTGGCCGGAACCTGCTGCGGGCCGGGGGTTACTGGAGTCCA
GCCGCCGTGGCGGATGAGTTTGAAGACATGACGGCCATGGCCATTGCCTGGAACGGCCAGGCTGATCGATATATC
GTGGTTCAGCCGCACCGCGACCTGTTCTGGCTGGAGCCACAGGACTGGAAGACGACGGTTGACTGGCGCACGCTC
TTTGTCGACCTCCCCTTCTCGTCTTCTCTGCGAGGCTACGGTCATCTCAGTCACATCGCCGTCGAGTTTGACCAG
AGCTGGAACGTCCATCTCCCCAAGGATCTCCCAGCCCTGCTGAAAGAGTCGAGCCCTCGAGGTTTCATCGCCCGG
GCAATGGCTGAATGTGCCACCAATCGGCTGTACTCCTTCATCTGGCTCGTCGACCGTCACCTGGTCCGAGATGCT
CCCGTACAGGAAGAGGCGATGGAGATAGATACTGAAGAAGAGGCTGAAGAGACAGACCAGCCCATGACCTTTTAC
GACTGTCGGGACGTTTACGTCGAGACGGAACGGGAGGATCTCGAGCTGAGCCGGTATTCGACTCAGGCCGAGTAC
GAGAAGACGGCTGTTTACTTTTTGCAGCGGCTGGGGACGATTGGGAATGGTGATTACGCCCTGATGGGCAATGAC
TCGGGGGAGCCGGATGGCTTCGAGTTTACCGTGGATGATTATCTCGGTGTGTTGGCGCTTGTATAG
Gene >Ophun1|3500
ATGGCTACATCCTCCTTCCAGCTCTTCCCTCTCCTCCCCTGCGAGCTAAGGCTCGAGGTATGGAAAATGGCGATT
CGTCCGGCCGGCGCCGGCGTCCACCGGATATCCCTCCGGGACAGCAGCAGCAGCAGCAGCAGTCCGTCCGTGTCC
GGCAACACCCTACGGGCCGTCCCAGCCGGAGACAAGCAAGAGTCTCGCCGGCGGCACATTGCCGTCGCCGAGCCC
GAGGCGTCCGGATCGTCGGCCTCCCTCTGGGACGCCGGCCTGTGGACGGCCTGCAGCGAGAGCCGGCAGGTCATG
ATGTGGCACTTCAGGCTGCAGTTCTGGCAAGACGCTGGCCGGAACCTGCTGCGGGCCGGGGGTTACTGGAGTCCA
GCCGCCGTGGCGGATGAGTTTGAAGACATGACGGCCATGGCCATTGCCTGGAACGGCCAGGCTGATCGATATATC
GTGGTTCAGCCGCACCGCGACCTGTTCTGGCTGGAGCCACAGGACTGGAAGACGACGGTTGACTGGCGCACGCTC
TTTGTCGACCTCCCCTTCTCGTCTTCTCTGCGAGGCTACGGTCATCTCAGTCACATCGCCGTCGAGTTTGACCAG
AGCTGGAACGTCCATCTCCCCAAGGATCTCCCAGCCCTGCTGAAAGAGTCGAGCCCTCGAGGTTTCATCGCCCGG
GCAATGGCTGAATGTGCCACCAATCGGCTGTACTCCTTCATCTGGCTCGTCGACCGTCACCTGGTCCGAGATGCT
CCCGTACAGGAAGAGGCGATGGAGATAGATACTGAAGAAGAGGCTGAAGAGACAGACCAGCCCATGACCTTTTAC
GACTGTCGGGACGTTTACGTCGAGACGGAACGGGAGGATCTCGAGCTGAGCCGGTATTCGACTCAGGCCGAGTAC
GAGAAGACGGCTGTTTACTTTTTGCAGCGGCTGGGGACGATTGGGAATGGTGATTACGCCCTGATGGGCAATGAC
TCGGGGGAGCCGGATGGCTTCGAGTTTACCGTGGATGATTATCTCGGTGTGTTGGCGCTTGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail