Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3496
Gene name
LocationContig_31:44794..45416
Strand-
Gene length (bp)622
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02982 Scytalone_dh Scytalone dehydratase 2.0E-71 19 188
PF13577 SnoaL_4 SnoaL-like domain 2.7E-05 53 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14434|SCYD_ASPFU Probable scytalone dehydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp1 PE=2 SV=1 13 189 8.0E-76
sp|P56221|SCYD_MAGO7 Scytalone dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SDH1 PE=1 SV=1 19 187 1.0E-60
sp|Q00455|SCYD_COLOR Scytalone dehydratase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=SCD1 PE=3 SV=1 18 186 2.0E-59

GO

GO Term Description Terminal node
GO:0030411 scytalone dehydratase activity Yes
GO:0006582 melanin metabolic process Yes
GO:0016829 lyase activity No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016836 hydro-lyase activity No
GO:0003824 catalytic activity No
GO:0016835 carbon-oxygen lyase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018958 phenol-containing compound metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0042440 pigment metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0019748 secondary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3496
MPAPSIPPPANGKKNRQSLPFEDYLELSELVFEWGDSYDSKVSMRFIPAASNAYSQQDWSRLSSIIAPTLLVDYT
KIGKPRWESMPADEFIAMVSDDDFLGDPCVKTQHLLGATRWERVSETEVIGHHQLRAAHQVYTAPDLKTVKLRGH
SHATNEHYYTKVDGVWKFAGLKPNVRWNEHDFERVFKGSFK*
Coding >Ophun1|3496
ATGCCCGCGCCGTCAATCCCTCCTCCTGCCAATGGCAAGAAAAACAGGCAGTCGCTGCCTTTTGAAGACTATCTC
GAGCTATCTGAGCTGGTCTTTGAATGGGGTGACAGCTACGACTCCAAGGTCAGCATGCGCTTCATTCCCGCCGCT
TCAAATGCTTACTCCCAGCAGGACTGGTCTCGTCTTTCGTCCATCATTGCCCCTACCCTGCTCGTCGACTACACG
AAAATCGGAAAGCCGAGATGGGAGTCGATGCCCGCCGATGAGTTCATCGCCATGGTCTCTGACGATGACTTCCTC
GGCGATCCCTGCGTCAAGACGCAGCATCTTCTGGGGGCTACCCGGTGGGAACGCGTCTCCGAGACGGAGGTCATC
GGCCATCATCAGCTTAGGGCCGCGCATCAGGTTTACACGGCGCCTGACTTGAAGACGGTTAAGCTTAGGGGTCAT
AGCCACGCGACTAATGAGCATTACTATACCAAGGTGGATGGCGTGTGGAAGTTTGCGGGCTTGAAGCCGAATGTG
CGGTGGAATGAGCACGACTTTGAACGGGTTTTTAAGGGGTCCTTTAAGTAG
Transcript >Ophun1|3496
ATGCCCGCGCCGTCAATCCCTCCTCCTGCCAATGGCAAGAAAAACAGGCAGTCGCTGCCTTTTGAAGACTATCTC
GAGCTATCTGAGCTGGTCTTTGAATGGGGTGACAGCTACGACTCCAAGGTCAGCATGCGCTTCATTCCCGCCGCT
TCAAATGCTTACTCCCAGCAGGACTGGTCTCGTCTTTCGTCCATCATTGCCCCTACCCTGCTCGTCGACTACACG
AAAATCGGAAAGCCGAGATGGGAGTCGATGCCCGCCGATGAGTTCATCGCCATGGTCTCTGACGATGACTTCCTC
GGCGATCCCTGCGTCAAGACGCAGCATCTTCTGGGGGCTACCCGGTGGGAACGCGTCTCCGAGACGGAGGTCATC
GGCCATCATCAGCTTAGGGCCGCGCATCAGGTTTACACGGCGCCTGACTTGAAGACGGTTAAGCTTAGGGGTCAT
AGCCACGCGACTAATGAGCATTACTATACCAAGGTGGATGGCGTGTGGAAGTTTGCGGGCTTGAAGCCGAATGTG
CGGTGGAATGAGCACGACTTTGAACGGGTTTTTAAGGGGTCCTTTAAGTAG
Gene >Ophun1|3496
ATGCCCGCGCCGTCAATCCCTCCTCCTGCCAATGGCAAGAAAAACAGGCAGTCGCTGCCTTTTGAAGGTAACTCT
CCCACTCTTCGTCTACAACTAAGCTAACATTGTCTCAGACTATCTCGAGCTATCTGAGCTGGTCTTTGAATGGGG
TGACAGCTACGACTCCAAGGTCAGCATGCGCTTCATTCCCGCCGCTTCAAATGCTTACTCCCAGCAGGACTGGTC
TCGTCTTTCGTCCATCATTGCCCCTACCCTGCTCGTCGACTACACGAAAATCGGAAAGCCGAGATGGGAGTCGAT
GCCCGCCGATGAGTTCATCGCCATGGTCTCTGACGATGACTTCCTCGGCGATCCCTGCGTCAAGACGCAGCATCT
TCTGGGGGCTACCCGGTGGGAACGCGTCTCCGAGACGGAGGTCATCGGCCATCATCAGCTTAGGGCCGCGCATCA
GGTTTACACGGCGCCTGACTTGAAGACGGTTAAGCTTAGGGGTCATAGCCACGCGACTAATGAGCATTACTATAC
CAAGGTGGATGGCGTGTGGAAGTTTGCGGGCTTGAAGCCGAATGTGCGGTGGAATGAGCACGACTTTGAACGGGT
TTTTAAGGGGTCCTTTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail