Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3493
Gene name
LocationContig_31:37507..39012
Strand-
Gene length (bp)1505
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 4.6E-06 312 376

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 124 142 18
2 155 174 19
3 189 211 22
4 231 253 22
5 273 295 22
6 308 330 22
7 350 369 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3493
MEAPMDAETAPPGDAPPPPMEAPPADPAASEMPPDPAAMMMPGAPPGAPPGAPPDAPPGVPPGAPPGAPPPGAPP
GAPPGAPPGAPPGFPPGGLPGAPFGPPPGPKDIINGPFFGLVPTPVEDGLPALVFLLIFGAGYFLHARQLSRNKK
RRHKFLASIPFMAFCQTRVFTCLFRFTWAFLKAPFPRGVVFMTLFFDNAGLPFIYGVNIVLTQRIVRVMQPAIGW
HPVFNITVLVLLITIPIILLASIIGLMVLFFANQDKINQEFILDMLEAFAVWKVLLAIMPLIWIFVACALPGPPP
RNFGTGDLRFKTSLVVFSSVTLGIGQAVRLAATANPLLAFTGSAVFGKPMFYLIGFLLETLTVFSYIIFRFDNLF
YVPDGARDPRDYERGMESAGWTISRIKSAMAGLGFRHEFLRAPEYPDQAPVYALIYPDGIEPTSSAALPPVEGRK
PPPQYIERSVERQTRNQSAFSWDSTTDAKTFI*
Coding >Ophun1|3493
ATGGAGGCTCCTATGGACGCAGAGACAGCGCCTCCAGGAGATGCGCCTCCCCCTCCCATGGAGGCGCCGCCGGCC
GATCCAGCCGCCTCGGAGATGCCACCGGATCCGGCCGCCATGATGATGCCGGGGGCTCCTCCGGGGGCTCCTCCG
GGGGCTCCTCCCGATGCTCCTCCTGGCGTTCCTCCCGGCGCTCCTCCCGGCGCTCCTCCACCGGGTGCTCCTCCG
GGTGCTCCTCCGGGTGCTCCTCCGGGTGCTCCTCCGGGGTTTCCTCCCGGTGGTCTCCCCGGTGCTCCTTTTGGT
CCCCCTCCAGGCCCCAAAGACATCATCAACGGGCCCTTCTTCGGTCTCGTCCCAACCCCCGTTGAGGACGGACTG
CCGGCTCTCGTCTTCCTCCTCATCTTCGGCGCGGGTTACTTCTTGCACGCACGCCAGCTGAGCCGCAACAAGAAG
CGACGTCACAAGTTCCTCGCATCTATACCCTTCATGGCTTTTTGCCAGACGCGCGTCTTCACTTGTCTCTTTCGC
TTTACCTGGGCCTTTCTGAAGGCTCCTTTCCCCCGAGGCGTCGTGTTTATGACACTCTTCTTTGACAACGCTGGG
CTTCCTTTTATATACGGCGTCAACATCGTCCTGACGCAGCGCATAGTCCGCGTCATGCAGCCTGCCATCGGCTGG
CATCCCGTCTTCAACATCACCGTTCTAGTCTTGCTCATCACCATCCCAATCATTCTCCTTGCTTCCATCATTGGT
CTGATGGTCCTCTTCTTCGCAAACCAAGACAAGATCAACCAAGAATTTATCCTCGACATGCTCGAGGCCTTTGCA
GTATGGAAGGTTTTGCTTGCCATCATGCCTCTCATATGGATCTTCGTCGCCTGCGCATTGCCAGGCCCGCCCCCG
AGGAACTTCGGAACTGGCGATCTCCGCTTCAAGACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGGCATCGGA
CAGGCCGTGAGACTCGCTGCGACGGCCAACCCTCTGCTGGCCTTTACCGGATCAGCCGTCTTCGGAAAGCCCATG
TTCTACCTAATAGGCTTCTTGCTCGAAACGTTAACCGTCTTCTCCTATATAATCTTCCGGTTCGATAACCTTTTC
TACGTCCCGGATGGCGCTCGAGACCCTCGCGACTACGAAAGGGGCATGGAATCTGCCGGCTGGACGATTTCTCGC
ATAAAGTCTGCCATGGCTGGGCTGGGTTTCAGGCACGAGTTCTTGCGAGCGCCCGAGTACCCAGATCAGGCGCCC
GTCTATGCTCTCATCTACCCAGATGGCATCGAGCCTACAAGTTCAGCTGCACTACCGCCTGTTGAAGGACGCAAG
CCGCCACCGCAATACATTGAAAGAAGCGTGGAGAGGCAGACGAGAAACCAATCAGCCTTTAGCTGGGATTCGACG
ACCGACGCAAAGACCTTTATATGA
Transcript >Ophun1|3493
ATGGAGGCTCCTATGGACGCAGAGACAGCGCCTCCAGGAGATGCGCCTCCCCCTCCCATGGAGGCGCCGCCGGCC
GATCCAGCCGCCTCGGAGATGCCACCGGATCCGGCCGCCATGATGATGCCGGGGGCTCCTCCGGGGGCTCCTCCG
GGGGCTCCTCCCGATGCTCCTCCTGGCGTTCCTCCCGGCGCTCCTCCCGGCGCTCCTCCACCGGGTGCTCCTCCG
GGTGCTCCTCCGGGTGCTCCTCCGGGTGCTCCTCCGGGGTTTCCTCCCGGTGGTCTCCCCGGTGCTCCTTTTGGT
CCCCCTCCAGGCCCCAAAGACATCATCAACGGGCCCTTCTTCGGTCTCGTCCCAACCCCCGTTGAGGACGGACTG
CCGGCTCTCGTCTTCCTCCTCATCTTCGGCGCGGGTTACTTCTTGCACGCACGCCAGCTGAGCCGCAACAAGAAG
CGACGTCACAAGTTCCTCGCATCTATACCCTTCATGGCTTTTTGCCAGACGCGCGTCTTCACTTGTCTCTTTCGC
TTTACCTGGGCCTTTCTGAAGGCTCCTTTCCCCCGAGGCGTCGTGTTTATGACACTCTTCTTTGACAACGCTGGG
CTTCCTTTTATATACGGCGTCAACATCGTCCTGACGCAGCGCATAGTCCGCGTCATGCAGCCTGCCATCGGCTGG
CATCCCGTCTTCAACATCACCGTTCTAGTCTTGCTCATCACCATCCCAATCATTCTCCTTGCTTCCATCATTGGT
CTGATGGTCCTCTTCTTCGCAAACCAAGACAAGATCAACCAAGAATTTATCCTCGACATGCTCGAGGCCTTTGCA
GTATGGAAGGTTTTGCTTGCCATCATGCCTCTCATATGGATCTTCGTCGCCTGCGCATTGCCAGGCCCGCCCCCG
AGGAACTTCGGAACTGGCGATCTCCGCTTCAAGACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGGCATCGGA
CAGGCCGTGAGACTCGCTGCGACGGCCAACCCTCTGCTGGCCTTTACCGGATCAGCCGTCTTCGGAAAGCCCATG
TTCTACCTAATAGGCTTCTTGCTCGAAACGTTAACCGTCTTCTCCTATATAATCTTCCGGTTCGATAACCTTTTC
TACGTCCCGGATGGCGCTCGAGACCCTCGCGACTACGAAAGGGGCATGGAATCTGCCGGCTGGACGATTTCTCGC
ATAAAGTCTGCCATGGCTGGGCTGGGTTTCAGGCACGAGTTCTTGCGAGCGCCCGAGTACCCAGATCAGGCGCCC
GTCTATGCTCTCATCTACCCAGATGGCATCGAGCCTACAAGTTCAGCTGCACTACCGCCTGTTGAAGGACGCAAG
CCGCCACCGCAATACATTGAAAGAAGCGTGGAGAGGCAGACGAGAAACCAATCAGCCTTTAGCTGGGATTCGACG
ACCGACGCAAAGACCTTTATATGA
Gene >Ophun1|3493
ATGGAGGCTCCTATGGACGCAGAGACAGCGCCTCCAGGAGATGCGCCTCCCCCTCCCATGGAGGCGCCGCCGGCC
GATCCAGCCGCCTCGGAGATGCCACCGGATCCGGCCGCCATGATGATGCCGGGGGCTCCTCCGGGGGCTCCTCCG
GGGGCTCCTCCCGATGCTCCTCCTGGCGTTCCTCCCGGCGCTCCTCCCGGCGCTCCTCCACCGGGTGCTCCTCCG
GGTGCTCCTCCGGGTGCTCCTCCGGGTGCTCCTCCGGGGTTTCCTCCCGGTGGTCTCCCCGGTGCTCCTTTTGGT
CCCCCTCCAGGCCCCAAAGACATCATCAACGGGCCCTTCTTCGGTCTCGTCCCAACCCCCGTTGAGGACGGACTG
CCGGCTCTCGTCTTCCTCCTCATCTTCGGCGCGGGTTACTTCTTGCACGCACGCCAGCTGAGCCGCAACAAGAAG
CGACGTCACAAGTTCCTCGCATCTATACCCTTCATGGCTTTTTGCCAGACGCGCGTCTTCACTTGTCTCTTTCGC
TTTACCTGGGCCTTTCTGAAGGCTCCTTTCCCCCGAGGCGTCGTGTTTATGACACTCTTCTTTGACAACGCTGGG
TTCGTATCTGCTGCTTCTCGCATCACGTCAATCTCAACTCACAATCTCTGCTCAGGCTTCCTTTTATATACGGCG
TCAACATCGTCCTGACGCAGCGCATAGTCCGCGTCATGCAGCCTGCCATCGGCTGGCATCCCGTCTTCAACATCA
CCGTTCTAGTCTTGCTCATCACCATCCCAATCATTCTCCTTGCTTCCATCATTGGTCTGATGGTCCTCTTCTTCG
CAAACCAAGACAAGATCAACCAAGAATTTATCCTCGACATGCTCGAGGCCTTTGCAGTATGGAAGGTTTTGCTTG
CCATCATGCCTCTCATATGGATCTTCGTCGCCTGCGCATTGCCAGGCCCGCCCCCGAGGAACTTCGGAACTGGCG
ATCTCCGCTTCAAGACGTCGTTGGTCGTCTTCAGCTCCGTCACCCTGGGCATCGGACAGGCCGTGAGACTCGCTG
CGACGGCCAACCCTCTGCTGGCCTTTACCGGATCAGCCGTCTTCGGAAAGCCCATGTTCTACCTAATAGGCTTCT
TGCTCGAAACGTTAACCGTCTTCTCCTATATAATCTTCCGGTTCGATAACCTTTTCTACGTCCCGGATGGCGCTC
GAGACCCTCGCGACTACGAAAGGGGCATGGAATCTGCCGGCTGGACGATTTCTCGCATAAAGTCTGCCATGGCTG
GGCTGGGTTTCAGGCACGAGTTCTTGCGAGCGCCCGAGTACCCAGATCAGGCGCCCGTCTATGCTCTCATCTACC
CAGATGGCATCGAGCCTACAAGTTCAGCTGCACTACCGCCTGTTGAAGGACGCAAGCCGCCACCGCAATACATTG
AAAGAAGCGTGGAGAGGCAGACGAGAAACCAATCAGCCTTTAGCTGGGATTCGACGACCGACGCAAAGACCTTTA
TATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail