Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3490
Gene name
LocationContig_31:32759..34598
Strand-
Gene length (bp)1839
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10453 NUFIP1 Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1) 1.2E-08 324 355

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2783
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1053
Ophiocordyceps australis map64 (Brazil) OphauB2|7182
Ophiocordyceps camponoti-floridani Ophcf2|06410
Ophiocordyceps camponoti-rufipedis Ophun1|3490 (this protein)
Ophiocordyceps kimflemingae Ophio5|6411
Ophiocordyceps subramaniannii Hirsu2|4443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3490
MTGYGYGPPPPPPLPSSYGQSSSSYGYHGHHRGGGVSGGRGRGGQYSRGRGDFHAAPAPPLHYEYGAQPYSYPVS
QPPAVTYPPHPQQWTPEHVPPPSNTHPHAPAPISPSNYHPNYAPHYPPSQFSPQPPYGPPQQYGNPYHTPAAPQH
WNALGSAQQGHYGRGARSGPKPPHKGYEHESSAPVGVGYAQPYSHDPRAPHYPPAHYAYAGPPPPPAHVHHEANH
GQYHRRGRGGGYRDGARGRGGHHNNNGYSGGDKARHQQRQTTAAEVKVKTESPSLGKKKKRKTNTLGLTPGMDSE
SEDDEGEEKALLDLIGPETLQITDIAAFLAERRKNYPTKERVESKKAAELARREADKAALLEKQADRLRRQLRKV
ESSIKRKREQGDEGDEMRDSSEEPSDDEKPEVMSSRLDMAATPDASAKKADVSRHCKYYSTGGTCGKKGKCRFVH
DPEVREAAIKEREANDGRMTIQQRLILNDKEQEDLTILQSIQYLREKGLMKPAPQAQAGSDKDKADRSRVLRVER
PQKPVAAVSSLLPAAPASLPDPPVKREAGSARRNAPSSAASSGLEHYQGWLLQPYGSTDGKQAMTDDLP*
Coding >Ophun1|3490
ATGACCGGCTACGGTTACGGCCCGCCGCCGCCACCGCCGCTTCCTTCTTCCTACGGTCAGTCGAGCTCGTCGTAC
GGTTATCATGGTCATCATCGAGGAGGCGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCGCCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACGTTCCCCCACCCTCCAACACC
CATCCCCATGCCCCAGCCCCCATCTCCCCTTCCAACTACCATCCCAACTACGCACCTCATTACCCGCCCTCTCAG
TTCTCCCCTCAGCCGCCCTACGGTCCGCCCCAGCAGTATGGGAACCCATATCATACCCCGGCCGCGCCCCAGCAT
TGGAACGCTCTCGGCTCGGCGCAGCAGGGACATTACGGCAGAGGAGCCCGGTCTGGCCCCAAGCCCCCTCACAAG
GGCTACGAGCACGAGTCGTCCGCCCCAGTTGGCGTTGGCTACGCCCAGCCCTATTCCCACGACCCTCGCGCACCC
CATTACCCGCCTGCCCATTACGCTTACGCAGGACCTCCGCCGCCTCCGGCTCACGTCCACCACGAAGCCAATCAT
GGTCAGTACCATCGTCGTGGCAGAGGTGGTGGCTACAGAGACGGTGCACGCGGAAGAGGAGGCCATCATAATAAT
AACGGCTATTCTGGTGGGGACAAGGCTCGCCATCAACAGCGGCAAACCACCGCGGCCGAAGTAAAGGTCAAGACT
GAATCGCCATCGCTCGGAAAGAAGAAGAAGCGCAAGACGAATACTCTCGGTCTGACTCCCGGTATGGACTCGGAG
TCTGAAGATGACGAGGGAGAAGAGAAAGCTCTTCTCGATCTCATCGGACCCGAGACACTGCAGATTACCGATATC
GCTGCATTTTTGGCCGAGCGGCGGAAGAACTACCCAACAAAAGAGCGCGTCGAATCCAAAAAGGCTGCCGAGTTG
GCAAGGAGAGAAGCGGACAAGGCCGCCTTGCTGGAGAAGCAAGCCGACAGACTCCGAAGGCAGCTTCGGAAAGTC
GAGTCATCTATCAAGCGTAAGCGAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCGTCA
GACGATGAGAAGCCCGAAGTCATGTCTTCTCGTCTCGACATGGCTGCCACCCCTGACGCCTCGGCCAAGAAGGCT
GATGTCTCGAGGCACTGCAAATACTATTCCACCGGCGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCAT
GATCCTGAGGTTAGAGAAGCGGCTATCAAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCCAGCAGCGCCTC
ATTCTCAACGACAAGGAGCAGGAGGACTTGACCATCCTTCAGTCGATTCAGTACCTGCGCGAGAAGGGCCTCATG
AAGCCGGCGCCCCAGGCACAGGCGGGCAGCGACAAGGACAAGGCTGACAGGAGCCGCGTCTTGAGAGTGGAGAGG
CCGCAGAAGCCAGTGGCCGCCGTGTCGAGTCTGCTGCCGGCCGCTCCGGCCTCGCTTCCGGATCCGCCGGTCAAG
AGGGAGGCCGGCTCTGCCCGTCGGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAGCACTACCAGGGCTGG
CTGTTGCAGCCGTACGGCAGCACCGACGGGAAGCAGGCCATGACCGACGACTTGCCATGA
Transcript >Ophun1|3490
ATGACCGGCTACGGTTACGGCCCGCCGCCGCCACCGCCGCTTCCTTCTTCCTACGGTCAGTCGAGCTCGTCGTAC
GGTTATCATGGTCATCATCGAGGAGGCGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCGCCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACGTTCCCCCACCCTCCAACACC
CATCCCCATGCCCCAGCCCCCATCTCCCCTTCCAACTACCATCCCAACTACGCACCTCATTACCCGCCCTCTCAG
TTCTCCCCTCAGCCGCCCTACGGTCCGCCCCAGCAGTATGGGAACCCATATCATACCCCGGCCGCGCCCCAGCAT
TGGAACGCTCTCGGCTCGGCGCAGCAGGGACATTACGGCAGAGGAGCCCGGTCTGGCCCCAAGCCCCCTCACAAG
GGCTACGAGCACGAGTCGTCCGCCCCAGTTGGCGTTGGCTACGCCCAGCCCTATTCCCACGACCCTCGCGCACCC
CATTACCCGCCTGCCCATTACGCTTACGCAGGACCTCCGCCGCCTCCGGCTCACGTCCACCACGAAGCCAATCAT
GGTCAGTACCATCGTCGTGGCAGAGGTGGTGGCTACAGAGACGGTGCACGCGGAAGAGGAGGCCATCATAATAAT
AACGGCTATTCTGGTGGGGACAAGGCTCGCCATCAACAGCGGCAAACCACCGCGGCCGAAGTAAAGGTCAAGACT
GAATCGCCATCGCTCGGAAAGAAGAAGAAGCGCAAGACGAATACTCTCGGTCTGACTCCCGGTATGGACTCGGAG
TCTGAAGATGACGAGGGAGAAGAGAAAGCTCTTCTCGATCTCATCGGACCCGAGACACTGCAGATTACCGATATC
GCTGCATTTTTGGCCGAGCGGCGGAAGAACTACCCAACAAAAGAGCGCGTCGAATCCAAAAAGGCTGCCGAGTTG
GCAAGGAGAGAAGCGGACAAGGCCGCCTTGCTGGAGAAGCAAGCCGACAGACTCCGAAGGCAGCTTCGGAAAGTC
GAGTCATCTATCAAGCGTAAGCGAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCGTCA
GACGATGAGAAGCCCGAAGTCATGTCTTCTCGTCTCGACATGGCTGCCACCCCTGACGCCTCGGCCAAGAAGGCT
GATGTCTCGAGGCACTGCAAATACTATTCCACCGGCGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCAT
GATCCTGAGGTTAGAGAAGCGGCTATCAAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCCAGCAGCGCCTC
ATTCTCAACGACAAGGAGCAGGAGGACTTGACCATCCTTCAGTCGATTCAGTACCTGCGCGAGAAGGGCCTCATG
AAGCCGGCGCCCCAGGCACAGGCGGGCAGCGACAAGGACAAGGCTGACAGGAGCCGCGTCTTGAGAGTGGAGAGG
CCGCAGAAGCCAGTGGCCGCCGTGTCGAGTCTGCTGCCGGCCGCTCCGGCCTCGCTTCCGGATCCGCCGGTCAAG
AGGGAGGCCGGCTCTGCCCGTCGGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAGCACTACCAGGGCTGG
CTGTTGCAGCCGTACGGCAGCACCGACGGGAAGCAGGCCATGACCGACGACTTGCCATGA
Gene >Ophun1|3490
ATGACCGGCTACGGTTACGGCCCGCCGCCGCCACCGCCGCTTCCTTCTTCCTACGGTCAGTCGAGCTCGTCGTAC
GGTTATCATGGTCATCATCGAGGAGGCGGAGTCTCTGGCGGACGCGGTCGCGGCGGACAGTATTCCCGTGGTCGA
GGTGACTTCCACGCCGCTCCGGCTCCTCCCCTTCACTACGAATACGGAGCCCAGCCATACAGCTACCCCGTCTCG
CAACCTCCCGCCGTCACATATCCGCCTCATCCGCAGCAGTGGACCCCCGAACACGTTCCCCCACCCTCCAACACC
CATCCCCATGCCCCAGCCCCCATCTCCCCTTCCAACTACCATCCCAACTACGCACCTCATTACCCGCCCTCTCAG
TTCTCCCCTCAGCCGCCCTACGGTCCGCCCCAGCAGTATGGGAACCCATATCATACCCCGGCCGCGCCCCAGCAT
TGGAACGCTCTCGGCTCGGCGCAGCAGGGACATTACGGCAGAGGAGCCCGGTCTGGCCCCAAGCCCCCTCACAAG
GGCTACGAGCACGAGTCGTCCGCCCCAGTTGGCGTTGGCTACGCCCAGCCCTATTCCCACGACCCTCGCGCACCC
CATTACCCGCCTGCCCATTACGCTTACGCAGGACCTCCGCCGCCTCCGGCTCACGTCCACCACGAAGCCAATCAT
GGTCAGTACCATCGTCGTGGCAGAGGTGGTGGCTACAGAGACGGTGCACGCGGAAGAGGAGGCCATCATAATAAT
AACGGCTATTCTGGTGGGGACAAGGCTCGCCATCAACAGCGGCAAACCACCGCGGCCGAAGTAAAGGTCAAGACT
GAATCGCCATCGCTCGGAAAGAAGAAGAAGCGCAAGACGAATACTCTCGGTCTGACTCCCGGTATGGACTCGGAG
TCTGAAGATGACGAGGGAGAAGAGAAAGCTCTTCTCGATCTCATCGGACCCGAGACACTGCAGTAAGTTCTTACC
CCTTGCCATATCTGTTATCATTCTGCTAACTGGCAGCATAGGATTACCGATATCGCTGCATTTTTGGCCGAGCGG
CGGAAGAACTACCCAACAAAAGAGCGCGTCGAATCCAAAAAGGCTGCCGAGTTGGCAAGGAGAGAAGCGGACAAG
GCCGCCTTGCTGGAGAAGCAAGCCGACAGACTCCGAAGGCAGCTTCGGAAAGTCGAGTCATCTATCAAGCGTAAG
CGAGAGCAAGGCGACGAGGGTGACGAGATGAGAGACTCGTCGGAAGAGCCGTCAGACGATGAGAAGCCCGAAGTC
ATGTCTTCTCGTCTCGACATGGCTGCCACCCCTGACGCCTCGGCCAAGAAGGCTGATGTCTCGAGGCACTGCAAA
TACTATTCCACCGGCGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTTCATGATCCTGAGGTTAGAGAAGCG
GCTATCAAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCCAGCAGCGCCTCATTCTCAACGACAAGGAGCAG
GAGGACTTGACCATCCTTCAGTCGATTCAGTACCTGCGCGAGAAGGGCCTCATGAAGCCGGCGCCCCAGGCACAG
GCGGGCAGCGACAAGGACAAGGCTGACAGGAGCCGCGTCTTGAGAGTGGAGAGGCCGCAGAAGCCAGTGGCCGCC
GTGTCGAGTCTGCTGCCGGCCGCTCCGGCCTCGCTTCCGGATCCGCCGGTCAAGAGGGAGGCCGGCTCTGCCCGT
CGGAACGCGCCGTCATCCGCCGCGAGTTCGGGACTGGAGCACTACCAGGGCTGGCTGTTGCAGCCGTACGGCAGC
ACCGACGGGAAGCAGGCCATGACCGACGACTTGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail