Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3489
Gene name
LocationContig_31:30688..31837
Strand+
Gene length (bp)1149
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08243 SPT2 SPT2 chromatin protein 3.0E-08 263 352

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2782
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1054
Ophiocordyceps australis map64 (Brazil) OphauB2|7183
Ophiocordyceps camponoti-floridani Ophcf2|06409
Ophiocordyceps camponoti-rufipedis Ophun1|3489 (this protein)
Ophiocordyceps kimflemingae Ophio5|6410
Ophiocordyceps subramaniannii Hirsu2|4442

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3489
MPIGDLLAQISGENSSSAPTLQRTSNSTVPAKRKAENDLRPDVVKASRPMNPQPSKPTPVRTAAGGHGLQRAPPS
QRLVGAKAAASTSSLSGPAKTVRPVAGARPTSSPLASPSATPKQPLKKGSFAEIIARGQRAQAVMGQVGKIQHKK
VEKGATAKIKDDKPSAPAKTKAKTTPGYKGTSKPMTGVNTTANGTHSKNGARPRPTAPPKRHPDQDPTDKTAKRA
SQQPMTGYTGTARPKQALASKKKDIPRGGALLNAAPARHGSSKRSRYDEDDYDEELDDFIEYDDDEAAAARGPGY
GYGYASDASSDMEAGIDELDTEEQRAEILARREDIEEERLERSLKAAKEDRKRQALEALRAGRRR*
Coding >Ophun1|3489
ATGCCAATCGGAGACCTTCTGGCCCAGATCAGTGGCGAAAACTCGTCCTCGGCGCCGACTTTGCAGCGCACGTCT
AACTCGACAGTACCCGCCAAGCGAAAGGCCGAAAATGACCTGCGTCCCGACGTCGTCAAGGCTTCGCGCCCGATG
AATCCTCAGCCTTCGAAGCCGACTCCGGTCAGGACCGCTGCTGGGGGTCATGGCCTGCAGCGTGCGCCTCCGTCG
CAGCGACTCGTTGGTGCCAAGGCTGCTGCGTCTACTTCGTCGCTGTCTGGGCCTGCCAAGACGGTGCGGCCTGTT
GCTGGCGCTCGCCCGACGTCGAGCCCTTTGGCTTCCCCATCGGCGACGCCGAAACAACCTCTGAAGAAGGGCTCC
TTTGCCGAAATCATCGCCAGAGGTCAGCGTGCTCAGGCCGTAATGGGTCAGGTCGGCAAGATCCAGCACAAAAAG
GTGGAAAAGGGCGCGACGGCAAAGATCAAAGACGACAAGCCATCCGCACCGGCCAAAACGAAAGCAAAGACAACG
CCGGGATACAAGGGCACCTCCAAGCCCATGACCGGCGTCAACACCACCGCCAACGGCACCCACAGCAAGAACGGC
GCCCGTCCCAGACCTACCGCGCCCCCGAAGCGCCACCCCGACCAAGACCCCACCGACAAGACAGCCAAGCGAGCG
TCTCAGCAGCCCATGACGGGCTACACCGGCACCGCCCGCCCCAAGCAAGCCCTCGCCTCGAAGAAAAAGGACATC
CCCCGCGGAGGCGCCCTCCTCAACGCCGCACCCGCCCGCCACGGCTCTTCGAAACGATCCCGCTACGACGAAGAC
GATTACGACGAGGAACTCGACGATTTCATCGAGTACGACGACGACGAAGCTGCCGCCGCCCGAGGCCCAGGCTAC
GGCTACGGCTACGCTTCAGACGCCTCTTCCGACATGGAAGCCGGCATCGACGAGCTCGACACGGAAGAGCAGAGG
GCCGAAATCCTCGCCCGCCGCGAGGACATCGAAGAAGAACGTCTGGAGCGCTCCCTCAAGGCCGCAAAGGAAGAC
CGCAAACGCCAAGCCCTCGAAGCCCTTCGCGCCGGCAGACGTCGCTGA
Transcript >Ophun1|3489
ATGCCAATCGGAGACCTTCTGGCCCAGATCAGTGGCGAAAACTCGTCCTCGGCGCCGACTTTGCAGCGCACGTCT
AACTCGACAGTACCCGCCAAGCGAAAGGCCGAAAATGACCTGCGTCCCGACGTCGTCAAGGCTTCGCGCCCGATG
AATCCTCAGCCTTCGAAGCCGACTCCGGTCAGGACCGCTGCTGGGGGTCATGGCCTGCAGCGTGCGCCTCCGTCG
CAGCGACTCGTTGGTGCCAAGGCTGCTGCGTCTACTTCGTCGCTGTCTGGGCCTGCCAAGACGGTGCGGCCTGTT
GCTGGCGCTCGCCCGACGTCGAGCCCTTTGGCTTCCCCATCGGCGACGCCGAAACAACCTCTGAAGAAGGGCTCC
TTTGCCGAAATCATCGCCAGAGGTCAGCGTGCTCAGGCCGTAATGGGTCAGGTCGGCAAGATCCAGCACAAAAAG
GTGGAAAAGGGCGCGACGGCAAAGATCAAAGACGACAAGCCATCCGCACCGGCCAAAACGAAAGCAAAGACAACG
CCGGGATACAAGGGCACCTCCAAGCCCATGACCGGCGTCAACACCACCGCCAACGGCACCCACAGCAAGAACGGC
GCCCGTCCCAGACCTACCGCGCCCCCGAAGCGCCACCCCGACCAAGACCCCACCGACAAGACAGCCAAGCGAGCG
TCTCAGCAGCCCATGACGGGCTACACCGGCACCGCCCGCCCCAAGCAAGCCCTCGCCTCGAAGAAAAAGGACATC
CCCCGCGGAGGCGCCCTCCTCAACGCCGCACCCGCCCGCCACGGCTCTTCGAAACGATCCCGCTACGACGAAGAC
GATTACGACGAGGAACTCGACGATTTCATCGAGTACGACGACGACGAAGCTGCCGCCGCCCGAGGCCCAGGCTAC
GGCTACGGCTACGCTTCAGACGCCTCTTCCGACATGGAAGCCGGCATCGACGAGCTCGACACGGAAGAGCAGAGG
GCCGAAATCCTCGCCCGCCGCGAGGACATCGAAGAAGAACGTCTGGAGCGCTCCCTCAAGGCCGCAAAGGAAGAC
CGCAAACGCCAAGCCCTCGAAGCCCTTCGCGCCGGCAGACGTCGCTGA
Gene >Ophun1|3489
ATGCCAGTGAGTGTCTCCCCCAGACTTGTCCGACAGCGTCTCATGACTCCCTAGCAGATCGGAGACCTTCTGGCC
CAGATCAGTGGCGAAAACTCGTCCTCGGCGCCGACTTTGCAGCGCACGTCTAACTCGACAGTACCCGCCAAGCGA
AAGGCCGAAAATGACCTGCGTCCCGACGTCGTCAAGGCTTCGCGCCCGATGAATCCTCAGCCTTCGAAGCCGACT
CCGGTCAGGACCGCTGCTGGGGGTCATGGCCTGCAGCGTGCGCCTCCGTCGCAGCGACTCGTTGGTGCCAAGGCT
GCTGCGTCTACTTCGTCGCTGTCTGGGCCTGCCAAGACGGTGCGGCCTGTTGCTGGCGCTCGCCCGACGTCGAGC
CCTTTGGCTTCCCCATCGGCGACGCCGAAACAACCTCTGAAGAAGGGCTCCTTTGCCGAAATCATCGCCAGAGGT
CAGCGTGCTCAGGCCGTAATGGGTCAGGTCGGCAAGATCCAGCACAAAAAGGTGGAAAAGGGCGCGACGGCAAAG
ATCAAAGACGACAAGCCATCCGCACCGGCCAAAACGAAAGCAAAGACAACGCCGGGATACAAGGGCACCTCCAAG
CCCATGACCGGCGTCAACACCACCGCCAACGGCACCCACAGCAAGAACGGCGCCCGTCCCAGACCTACCGCGCCC
CCGAAGCGCCACCCCGACCAAGACCCCACCGACAAGACAGCCAAGCGAGCGTCTCAGCAGCCCATGACGGGCTAC
ACCGGCACCGCCCGCCCCAAGCAAGCCCTCGCCTCGAAGAAAAAGGACATCCCCCGCGGAGGCGCCCTCCTCAAC
GCCGCACCCGCCCGCCACGGCTCTTCGAAACGATCCCGCTACGACGAAGACGATTACGACGAGGAACTCGACGAT
TTCATCGAGTACGACGACGACGAAGCTGCCGCCGCCCGAGGCCCAGGCTACGGCTACGGCTACGCTTCAGACGCC
TCTTCCGACATGGAAGCCGGCATCGACGAGCTCGACACGGAAGAGCAGAGGGCCGAAATCCTCGCCCGCCGCGAG
GACATCGAAGAAGAACGTCTGGAGCGCTCCCTCAAGGCCGCAAAGGAAGACCGCAAACGCCAAGCCCTCGAAGCC
CTTCGCGCCGGCAGACGTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail