Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3484
Gene name
LocationContig_31:22016..22955
Strand+
Gene length (bp)939
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain 8.0E-34 45 151
PF13534 Fer4_17 4Fe-4S dicluster domain 1.3E-09 188 261
PF13237 Fer4_10 4Fe-4S dicluster domain 4.5E-08 188 257
PF13183 Fer4_8 4Fe-4S dicluster domain 1.9E-07 186 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42772|SDHB_ZYMTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Zymoseptoria tritici GN=SDH2 PE=3 SV=1 29 275 2.0E-147
sp|Q75CI4|SDHB_ASHGO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDH2 PE=3 SV=1 23 276 3.0E-135
sp|Q6FWS8|SDHB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 15 275 4.0E-133
sp|P32420|SDHB_USTMA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SDH2 PE=3 SV=1 3 277 9.0E-132
sp|P21801|SDHB_YEAST Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH2 PE=1 SV=1 11 276 4.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42772|SDHB_ZYMTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Zymoseptoria tritici GN=SDH2 PE=3 SV=1 29 275 2.0E-147
sp|Q75CI4|SDHB_ASHGO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDH2 PE=3 SV=1 23 276 3.0E-135
sp|Q6FWS8|SDHB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 15 275 4.0E-133
sp|P32420|SDHB_USTMA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SDH2 PE=3 SV=1 3 277 9.0E-132
sp|P21801|SDHB_YEAST Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH2 PE=1 SV=1 11 276 4.0E-131
sp|Q70KF8|SDHB_UROFA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Uromyces fabae GN=SDH2 PE=3 SV=1 43 274 8.0E-128
sp|B0BM36|SDHB_XENTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus tropicalis GN=sdhb PE=2 SV=1 1 274 5.0E-127
sp|Q3B8J8|SDHB_XENLA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus laevis GN=sdhb PE=2 SV=1 42 275 7.0E-127
sp|Q9YHT2|SDHB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Gallus gallus GN=SDHB PE=1 SV=1 15 274 8.0E-127
sp|P21913|SDHB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus GN=Sdhb PE=2 SV=2 34 274 6.0E-126
sp|A5PL98|SDHB_DANRE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Danio rerio GN=sdhb PE=2 SV=1 1 274 9.0E-126
sp|P21914|SDHB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster GN=SdhB PE=2 SV=2 10 274 2.0E-125
sp|P21911|SDHB_SCHPO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh2 PE=3 SV=3 27 274 1.0E-124
sp|P21912|SDHB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens GN=SDHB PE=1 SV=3 34 274 1.0E-124
sp|Q9CQA3|SDHB_MOUSE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mus musculus GN=Sdhb PE=1 SV=1 34 274 2.0E-124
sp|Q3T189|SDHB_BOVIN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Bos taurus GN=SDHB PE=2 SV=1 34 274 2.0E-123
sp|Q007T0|SDHB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Sus scrofa GN=SDHB PE=1 SV=1 34 274 8.0E-123
sp|Q09545|SDHB_CAEEL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis elegans GN=sdhb-1 PE=2 SV=1 25 270 1.0E-117
sp|A8WPF0|SDHB_CAEBR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis briggsae GN=sdhb-1 PE=3 SV=2 35 270 1.0E-114
sp|Q1RGP3|SDHB_RICBR Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhB PE=3 SV=1 43 274 7.0E-114
sp|Q9ZEA1|SDHB_RICPR Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhB PE=3 SV=1 34 274 2.0E-113
sp|Q4UN71|SDHB_RICFE Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhB PE=3 SV=1 34 274 4.0E-113
sp|Q68XS0|SDHB_RICTY Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhB PE=3 SV=1 34 274 8.0E-113
sp|Q92JJ8|SDHB_RICCN Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhB PE=3 SV=1 34 274 2.0E-112
sp|Q8LBZ7|SDHB1_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH2-1 PE=1 SV=2 43 271 8.0E-112
sp|Q8LB02|SDHB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH2-2 PE=1 SV=2 43 271 1.0E-111
sp|Q59662|SDHB_PARDE Succinate dehydrogenase iron-sulfur subunit OS=Paracoccus denitrificans GN=sdhB PE=3 SV=1 43 274 3.0E-111
sp|P80480|SDHB_RECAM Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Reclinomonas americana GN=SDH2 PE=3 SV=1 39 275 1.0E-109
sp|Q55CC2|SDHB_DICDI Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhB PE=3 SV=1 8 274 6.0E-104
sp|Q9S827|SDHB1_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH2-1 PE=1 SV=1 44 271 9.0E-103
sp|Q9FJP9|SDHB3_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial OS=Arabidopsis thaliana GN=SDH2-3 PE=1 SV=1 4 270 2.0E-101
sp|P48932|SDHB_CHOCR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Chondrus crispus GN=SDH2 PE=3 SV=1 37 270 1.0E-97
sp|P48933|SDHB_CYACA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Cyanidium caldarium GN=SDH2 PE=3 SV=1 43 273 6.0E-97
sp|P80477|SDHB_PORPU Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Porphyra purpurea GN=SDH2 PE=3 SV=1 43 276 3.0E-94
sp|Q6H4G3|SDHB2_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH2-2 PE=1 SV=1 43 276 5.0E-94
sp|P07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit OS=Escherichia coli (strain K12) GN=sdhB PE=1 SV=1 46 273 2.0E-81
sp|Q8ZQU2|SDHB_SALTY Succinate dehydrogenase iron-sulfur subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sdhB PE=3 SV=2 46 270 4.0E-81
sp|P51053|SDHB_COXBU Succinate dehydrogenase iron-sulfur subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sdhB PE=3 SV=1 45 273 4.0E-66
sp|P9WN89|FRDB_MYCTU Fumarate reductase iron-sulfur subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=frdB PE=1 SV=1 45 274 1.0E-41
sp|P9WN88|FRDB_MYCTO Fumarate reductase iron-sulfur subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=frdB PE=3 SV=1 45 274 1.0E-41
sp|P44893|FRDB_HAEIN Fumarate reductase iron-sulfur subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frdB PE=3 SV=1 45 274 3.0E-40
sp|P0AC50|FRDB_SHIFL Fumarate reductase iron-sulfur subunit OS=Shigella flexneri GN=frdB PE=3 SV=2 46 272 5.0E-36
sp|P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit OS=Escherichia coli (strain K12) GN=frdB PE=1 SV=2 46 272 5.0E-36
sp|P0AC48|FRDB_ECOL6 Fumarate reductase iron-sulfur subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frdB PE=3 SV=2 46 272 5.0E-36
sp|P0AC49|FRDB_ECO57 Fumarate reductase iron-sulfur subunit OS=Escherichia coli O157:H7 GN=frdB PE=3 SV=2 46 272 5.0E-36
sp|P20921|FRDB_PROVU Fumarate reductase iron-sulfur subunit OS=Proteus vulgaris GN=frdB PE=3 SV=2 46 274 1.0E-34
sp|P17596|FRDB_WOLSU Fumarate reductase iron-sulfur subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=frdB PE=1 SV=1 42 274 1.0E-27
sp|D9PUX5|TFRB_METTM Fumarate reductase (CoM/CoB) subunit B OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=tfrB PE=1 SV=1 43 270 3.0E-26
sp|O06914|FRDB_HELPY Fumarate reductase iron-sulfur subunit OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=frdB PE=3 SV=2 42 273 1.0E-24
sp|Q9ZMP1|FRDB_HELPJ Fumarate reductase iron-sulfur subunit OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=frdB PE=3 SV=1 42 273 3.0E-24
sp|Q57557|Y092_METJA Uncharacterized iron-sulfur protein MJ0092 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0092 PE=3 SV=1 43 275 5.0E-24
sp|Q6LYC4|Y1067_METMP Uncharacterized iron-sulfur protein MMP1067 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1067 PE=3 SV=1 62 275 1.0E-21
sp|P08066|SDHB_BACSU Succinate dehydrogenase iron-sulfur subunit OS=Bacillus subtilis (strain 168) GN=sdhB PE=3 SV=3 81 277 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0009055 electron transfer activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0051540 metal cluster binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1436
Ophiocordyceps australis map64 (Brazil) OphauB2|6038
Ophiocordyceps camponoti-floridani Ophcf2|06404
Ophiocordyceps camponoti-rufipedis Ophun1|3484 (this protein)
Ophiocordyceps kimflemingae Ophio5|6405
Ophiocordyceps subramaniannii Hirsu2|7545

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3484
MAALYSSSRVLARTMLRPGAISVRSLATVSDVPQQQQQQQPRMKTFQVYRWNPDAPDEKPRMQSYSIDLNKTGPM
VLDALVRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPTESSSEVKLYPLPHTYVVKDLVPDLTHF
YKQYKSIKPYLQRETPAPDGKEYRQSKEERRKLDGLYECILCACCSTSCPSYWWNAQEYLGPAILLQSFRWLADS
RDERKAERKTNLENSMSLYRCHTILNCTRACPKGLNPGKAIAEVKKEMAFGA*
Coding >Ophun1|3484
ATGGCCGCCCTTTACTCCTCCTCCCGAGTCCTGGCCCGGACGATGCTCCGGCCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCGCAGCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACGTTCCAGGTCTACCGA
TGGAACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCTATG
GTGCTGGACGCCCTGGTTCGCATCAAGAATGAGTTGGATCCTACTTTGACTTTTCGTCGGAGTTGTCGGGAGGGC
ATCTGCGGTAGCTGTGCCATGAACATCAACGGCCAGAATACGCTGGCTTGCTTGTGTCGGATTCCTACAGAGTCG
TCCTCCGAGGTCAAGCTCTACCCGTTACCGCACACTTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTC
TACAAGCAGTACAAGTCCATCAAGCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGGCAAAGAGTATCGGCAG
TCAAAGGAGGAACGGCGGAAGCTAGACGGCCTGTACGAATGCATCCTCTGCGCATGCTGCTCGACATCGTGTCCG
TCGTACTGGTGGAACGCGCAAGAGTATCTCGGGCCTGCCATTCTGCTCCAGTCGTTCCGCTGGCTGGCCGACTCG
CGCGATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTCGATGAGTCTATACCGCTGTCACACCATCCTC
AACTGCACCCGCGCCTGTCCCAAGGGCCTCAACCCGGGCAAGGCCATTGCCGAGGTGAAGAAGGAGATGGCCTTT
GGCGCGTGA
Transcript >Ophun1|3484
ATGGCCGCCCTTTACTCCTCCTCCCGAGTCCTGGCCCGGACGATGCTCCGGCCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCGCAGCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACGTTCCAGGTCTACCGA
TGGAACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCTATG
GTGCTGGACGCCCTGGTTCGCATCAAGAATGAGTTGGATCCTACTTTGACTTTTCGTCGGAGTTGTCGGGAGGGC
ATCTGCGGTAGCTGTGCCATGAACATCAACGGCCAGAATACGCTGGCTTGCTTGTGTCGGATTCCTACAGAGTCG
TCCTCCGAGGTCAAGCTCTACCCGTTACCGCACACTTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTC
TACAAGCAGTACAAGTCCATCAAGCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGGCAAAGAGTATCGGCAG
TCAAAGGAGGAACGGCGGAAGCTAGACGGCCTGTACGAATGCATCCTCTGCGCATGCTGCTCGACATCGTGTCCG
TCGTACTGGTGGAACGCGCAAGAGTATCTCGGGCCTGCCATTCTGCTCCAGTCGTTCCGCTGGCTGGCCGACTCG
CGCGATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTCGATGAGTCTATACCGCTGTCACACCATCCTC
AACTGCACCCGCGCCTGTCCCAAGGGCCTCAACCCGGGCAAGGCCATTGCCGAGGTGAAGAAGGAGATGGCCTTT
GGCGCGTGA
Gene >Ophun1|3484
ATGGCCGCCCTTTACTCCTCCTCCCGAGTCCTGGCCCGGACGATGCTCCGGCCCGGAGCCATTTCCGTTCGCTCG
CTGGCTACCGTCAGCGATGTGCCGCAGCAGCAGCAGCAGCAGCAGCCTCGGATGAAGACGTTCCAGGTCTACCGA
TGGAACCCGGACGCGCCGGACGAGAAGCCGCGGATGCAGTCGTACTCGATTGACCTCAACAAGACGGGGCCTATG
GTGCTGGACGCCCTGGTTCGCATCAAGAATGAGTTGGATCCTACTTTGACTTTTCGTCGGAGTTGTCGGGAGGGC
ATCTGCGGTAGCTGTGCCATGAACATCAACGGCCAGAATACGCTGGCTTGCTTGTGTATGTTCCTGTTGCGACGC
TGGGCACATTGATCGTCTTCTTACACTTGTCACAGGTCGGATTCCTACAGAGTCGTCCTCCGAGGTCAAGCTCTA
CCCGTTACCGCACACTTACGTCGTCAAGGACCTGGTGCCCGACTTGACGCACTTCTACAAGCAGTACAAGTCCAT
CAAGCCCTACCTACAGCGCGAGACGCCCGCGCCCGACGTACGCAGCCATTGGAAACCCCGAAGCGATTTCCGCTG
ACGTTGATGCAGGGCAAAGAGTATCGGCAGTCAAAGGAGGAACGGCGGAAGCTAGACGGCCTGTACGAATGCATC
CTCTGCGCATGCTGCTCGACATCGTGTCCGTCGTACTGGTGGAACGCGCAAGAGTATCTCGGGCCTGCCATTCTG
CTCCAGTCGTTCCGCTGGCTGGCCGACTCGCGCGATGAGCGCAAGGCAGAGCGCAAGACGAACCTGGAGAACTCG
ATGAGTCTATACCGCTGTCACACCATCCTCAACTGCACCCGCGCCTGTCCCAAGGGCCTCAACCCGGGCAAGGCC
ATTGCCGAGGTGAAGAAGGAGATGGCCTTTGGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail