Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3474
Gene name
LocationContig_309:9141..10407
Strand+
Gene length (bp)1266
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00573 Ribosomal_L4 Ribosomal protein L4/L1 family 5.0E-35 24 267
PF14374 Ribos_L4_asso_C 60S ribosomal protein L4 C-terminal domain 8.2E-29 281 356

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P784|RL4B_SCHPO 60S ribosomal protein L4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl401 PE=3 SV=1 3 343 9.0E-157
sp|P35679|RL4A_SCHPO 60S ribosomal protein L4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl402 PE=1 SV=2 3 343 1.0E-156
sp|Q9SF40|RL4A_ARATH 60S ribosomal protein L4-1 OS=Arabidopsis thaliana GN=RPL4A PE=2 SV=1 3 340 9.0E-135
sp|P49626|RL4B_YEAST 60S ribosomal protein L4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4B PE=1 SV=2 3 359 2.0E-133
sp|P10664|RL4A_YEAST 60S ribosomal protein L4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4A PE=1 SV=4 3 359 3.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P784|RL4B_SCHPO 60S ribosomal protein L4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl401 PE=3 SV=1 3 343 9.0E-157
sp|P35679|RL4A_SCHPO 60S ribosomal protein L4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl402 PE=1 SV=2 3 343 1.0E-156
sp|Q9SF40|RL4A_ARATH 60S ribosomal protein L4-1 OS=Arabidopsis thaliana GN=RPL4A PE=2 SV=1 3 340 9.0E-135
sp|P49626|RL4B_YEAST 60S ribosomal protein L4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4B PE=1 SV=2 3 359 2.0E-133
sp|P10664|RL4A_YEAST 60S ribosomal protein L4-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4A PE=1 SV=4 3 359 3.0E-133
sp|P49691|RL4B_ARATH 60S ribosomal protein L4-2 OS=Arabidopsis thaliana GN=RPL4D PE=2 SV=2 3 340 3.0E-132
sp|P49165|RL4_URECA 60S ribosomal protein L4 OS=Urechis caupo GN=RPL4 PE=2 SV=1 1 339 7.0E-129
sp|P08429|RL4A_XENLA 60S ribosomal protein L4-A OS=Xenopus laevis GN=rpl4-a PE=2 SV=2 3 369 4.0E-126
sp|P02385|RL4B_XENLA 60S ribosomal protein L4-B OS=Xenopus laevis GN=rpl4-b PE=2 SV=2 3 369 1.0E-125
sp|Q58DW0|RL4_BOVIN 60S ribosomal protein L4 OS=Bos taurus GN=RPL4 PE=2 SV=3 3 340 2.0E-122
sp|Q9D8E6|RL4_MOUSE 60S ribosomal protein L4 OS=Mus musculus GN=Rpl4 PE=1 SV=3 3 340 6.0E-122
sp|P36578|RL4_HUMAN 60S ribosomal protein L4 OS=Homo sapiens GN=RPL4 PE=1 SV=5 3 340 7.0E-122
sp|Q5RCR3|RL4_PONAB 60S ribosomal protein L4 OS=Pongo abelii GN=RPL4 PE=2 SV=1 3 340 9.0E-122
sp|Q4R5P9|RL4_MACFA 60S ribosomal protein L4 OS=Macaca fascicularis GN=RPL4 PE=2 SV=1 3 340 1.0E-121
sp|P50878|RL4_RAT 60S ribosomal protein L4 OS=Rattus norvegicus GN=Rpl4 PE=1 SV=3 3 340 2.0E-121
sp|Q9XF97|RL4_PRUAR 60S ribosomal protein L4 OS=Prunus armeniaca GN=RPL4 PE=2 SV=1 4 340 5.0E-121
sp|Q28346|RL4_CANLF 60S ribosomal protein L4 OS=Canis lupus familiaris GN=RPL4 PE=1 SV=2 3 363 2.0E-118
sp|O02056|RL4_CAEEL 60S ribosomal protein L4 OS=Caenorhabditis elegans GN=rpl-4 PE=1 SV=3 1 355 4.0E-116
sp|P09180|RL4_DROME 60S ribosomal protein L4 OS=Drosophila melanogaster GN=RpL4 PE=1 SV=2 2 348 1.0E-114
sp|P49669|RL4_TRYBB 60S ribosomal protein L4 OS=Trypanosoma brucei brucei GN=RPL4 PE=3 SV=1 1 331 3.0E-112
sp|Q54Z69|RL4_DICDI 60S ribosomal protein L4 OS=Dictyostelium discoideum GN=rpl4 PE=1 SV=1 1 340 3.0E-112
sp|P0DJ55|RL4_TETTS 60S ribosomal protein L4 OS=Tetrahymena thermophila (strain SB210) GN=RPL4 PE=1 SV=1 1 346 6.0E-106
sp|O15594|RL4_ENTHI 60S ribosomal protein L4 (Fragments) OS=Entamoeba histolytica GN=RPL4 PE=2 SV=2 56 279 1.0E-67
sp|O26111|RL4_METTH 50S ribosomal protein L4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl4 PE=3 SV=1 23 269 8.0E-52
sp|Q12ZV0|RL4_METBU 50S ribosomal protein L4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl4 PE=3 SV=1 6 269 2.0E-46
sp|C6A160|RL4_THESM 50S ribosomal protein L4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl4 PE=3 SV=1 7 270 2.0E-44
sp|A5UL88|RL4_METS3 50S ribosomal protein L4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl4 PE=3 SV=1 23 269 1.0E-43
sp|A3CSZ8|RL4_METMJ 50S ribosomal protein L4 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl4 PE=3 SV=1 23 268 3.0E-43
sp|Q5JDI0|RL4_THEKO 50S ribosomal protein L4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl4 PE=3 SV=1 7 270 3.0E-43
sp|Q2NFV7|RL4_METST 50S ribosomal protein L4 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl4 PE=3 SV=1 23 269 3.0E-43
sp|B6YSL4|RL4_THEON 50S ribosomal protein L4 OS=Thermococcus onnurineus (strain NA1) GN=rpl4 PE=3 SV=1 7 270 3.0E-43
sp|Q2FU92|RL4_METHJ 50S ribosomal protein L4 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl4 PE=3 SV=1 23 265 9.0E-43
sp|Q8ZW51|RL4_PYRAE 50S ribosomal protein L4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl4 PE=3 SV=1 7 269 1.0E-42
sp|C5A285|RL4_THEGJ 50S ribosomal protein L4 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl4 PE=3 SV=1 7 270 7.0E-42
sp|B9LSS6|RL4_HALLT 50S ribosomal protein L4 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl4 PE=3 SV=1 13 265 7.0E-41
sp|O28355|RL4_ARCFU 50S ribosomal protein L4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl4 PE=3 SV=1 23 267 8.0E-41
sp|C3NEE4|RL4_SULIY 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl4 PE=3 SV=1 9 267 4.0E-40
sp|Q8TZZ9|RL4_PYRFU 50S ribosomal protein L4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl4 PE=1 SV=1 7 270 4.0E-40
sp|C3NHA8|RL4_SULIN 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl4 PE=3 SV=1 9 267 4.0E-40
sp|C3MVH9|RL4_SULIM 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl4 PE=3 SV=1 9 267 8.0E-40
sp|C4KHF7|RL4_SULIK 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl4 PE=3 SV=1 9 267 8.0E-40
sp|C3N5S8|RL4_SULIA 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl4 PE=3 SV=1 9 267 8.0E-40
sp|A0B9W9|RL4_METTP 50S ribosomal protein L4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl4 PE=3 SV=1 9 267 1.0E-39
sp|Q9UXA6|RL4_SULSO 50S ribosomal protein L4 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl4 PE=3 SV=1 8 267 1.0E-39
sp|Q9YFM1|RL4_AERPE 50S ribosomal protein L4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl4 PE=3 SV=3 23 272 1.0E-39
sp|Q9V1T6|RL4_PYRAB 50S ribosomal protein L4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl4 PE=3 SV=1 7 270 1.0E-39
sp|C3MQ60|RL4_SULIL 50S ribosomal protein L4 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl4 PE=3 SV=1 9 267 3.0E-39
sp|Q8PV49|RL4_METMA 50S ribosomal protein L4 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl4 PE=3 SV=1 1 266 9.0E-39
sp|O59420|RL4_PYRHO 50S ribosomal protein L4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl4 PE=3 SV=1 7 270 1.0E-38
sp|A7I5P0|RL4_METB6 50S ribosomal protein L4 OS=Methanoregula boonei (strain 6A8) GN=rpl4 PE=3 SV=1 23 266 1.0E-38
sp|Q18GF0|RL4_HALWD 50S ribosomal protein L4 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl4 PE=3 SV=1 19 265 3.0E-38
sp|Q8TRU6|RL4_METAC 50S ribosomal protein L4 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl4 PE=3 SV=1 1 266 3.0E-38
sp|Q46G96|RL4_METBF 50S ribosomal protein L4 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl4 PE=3 SV=1 23 266 2.0E-37
sp|Q8TY91|RL4_METKA 50S ribosomal protein L4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl4 PE=3 SV=1 19 271 5.0E-37
sp|Q4JB41|RL4_SULAC 50S ribosomal protein L4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl4 PE=3 SV=1 23 265 6.0E-37
sp|Q975I2|RL4_SULTO 50S ribosomal protein L4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl4 PE=3 SV=2 23 265 1.0E-36
sp|Q3IMY7|RL4_NATPD 50S ribosomal protein L4 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl4 PE=3 SV=1 13 262 4.0E-35
sp|Q9HIR0|RL4_THEAC 50S ribosomal protein L4 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl4 PE=3 SV=1 23 268 1.0E-33
sp|Q9HPD3|RL4_HALSA 50S ribosomal protein L4 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl4 PE=1 SV=1 7 265 1.0E-33
sp|B0R657|RL4_HALS3 50S ribosomal protein L4 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl4 PE=3 SV=1 7 265 1.0E-33
sp|A6UV67|RL4_META3 50S ribosomal protein L4 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl4 PE=3 SV=1 7 269 1.0E-33
sp|P54015|RL4_METJA 50S ribosomal protein L4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl4 PE=3 SV=1 23 269 3.0E-33
sp|A6UQJ1|RL4_METVS 50S ribosomal protein L4 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl4 PE=3 SV=1 6 269 3.0E-32
sp|A4FVY1|RL4_METM5 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl4 PE=3 SV=1 6 266 4.0E-32
sp|A9A9B7|RL4_METM6 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl4 PE=3 SV=1 6 266 4.0E-31
sp|P60846|RL4_METMP 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl4 PE=3 SV=1 6 266 4.0E-31
sp|Q97BX6|RL4_THEVO 50S ribosomal protein L4 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl4 PE=3 SV=1 23 267 8.0E-31
sp|A6VHD3|RL4_METM7 50S ribosomal protein L4 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl4 PE=3 SV=1 6 266 3.0E-30
sp|P12735|RL4_HALMA 50S ribosomal protein L4 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl4 PE=1 SV=4 8 262 3.0E-29
sp|P60847|RL4_NANEQ 50S ribosomal protein L4 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl4 PE=3 SV=1 23 267 2.0E-25
sp|P14117|RL4_XENTR 60S ribosomal protein L4 (Fragment) OS=Xenopus tropicalis GN=rpl4 PE=3 SV=1 237 329 4.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7144
Ophiocordyceps australis map64 (Brazil) OphauB2|3612
Ophiocordyceps camponoti-floridani Ophcf2|05076
Ophiocordyceps camponoti-rufipedis Ophun1|3474 (this protein)
Ophiocordyceps kimflemingae Ophio5|5211
Ophiocordyceps subramaniannii Hirsu2|1278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3474
MTSRPTVSIIGKDGAPTGSTHPMPAVFTSPIRPDIVQKVHTGMAKNRRQPYAVSEKAGHQTSAESWGTGRAVARI
PRVSGGGTHRAGQAAFGNMCRSGRMFAPTKIWRKWHIKINQGQKRYATCSAVAASAVAPLLMARGHQIMTIAEVP
LVVDSELFEGASLARTASAIALLRAVGAGADLDKVKASKKLRAGKGKLRGRRHRQRRGPLVVYSPEVDGKELVRG
FRNIPGIETCPVTALNLLQLAPGGHLGRFVIWTSAAFKALDEIYGSTTEPSALKRDFLLPSNVVCQADLTRLINS
SEIQSSLNAPKGDAITRRSAVQKKNPLRNKQVMLRLNPYAAVFAKEAAGKEGAKKEGAKKDGAKEGAKKESGKQE
SAKKGPAKKK*
Coding >Ophun1|3474
ATGACTTCGCGACCTACCGTCTCCATCATCGGCAAAGATGGTGCTCCCACGGGCAGCACGCATCCCATGCCCGCC
GTCTTCACCAGCCCCATCCGTCCCGACATCGTCCAAAAGGTGCACACCGGCATGGCGAAGAACAGGCGTCAGCCT
TATGCCGTGAGCGAAAAGGCTGGCCACCAGACCTCTGCCGAGTCTTGGGGAACGGGTCGTGCTGTCGCGCGTATC
CCTCGTGTGTCTGGTGGTGGTACCCACCGTGCTGGCCAGGCTGCCTTTGGTAACATGTGCCGTTCTGGCCGCATG
TTCGCGCCCACCAAGATCTGGCGCAAGTGGCACATTAAGATCAACCAGGGCCAGAAGCGCTACGCTACCTGCTCT
GCTGTGGCCGCCTCGGCCGTGGCACCCCTGCTGATGGCCCGTGGCCACCAGATCATGACGATCGCCGAAGTTCCC
CTTGTCGTCGACTCCGAGCTCTTTGAGGGCGCCTCGTTGGCCCGCACCGCGTCTGCCATTGCTCTTTTGAGGGCA
GTCGGCGCCGGCGCCGATTTGGACAAGGTCAAAGCCTCCAAGAAGCTCCGTGCCGGAAAGGGCAAGCTCCGTGGC
CGCCGTCACCGCCAACGTCGCGGCCCTCTTGTCGTCTACTCCCCCGAGGTCGATGGCAAGGAGCTTGTCAGGGGC
TTCCGCAACATTCCCGGCATCGAGACATGCCCCGTTACCGCCCTGAACCTCCTTCAGCTTGCTCCTGGCGGTCAT
CTTGGCCGCTTTGTCATCTGGACTTCGGCAGCCTTCAAGGCCCTCGACGAGATCTATGGTTCCACGACGGAGCCG
TCCGCCCTCAAGCGCGACTTCTTGCTGCCGTCCAACGTCGTCTGCCAAGCCGACCTGACGCGCCTGATCAACAGC
TCCGAAATCCAGAGCTCTCTCAACGCTCCCAAGGGCGACGCCATCACCCGACGGTCCGCCGTCCAAAAGAAGAAT
CCCCTGCGCAACAAGCAGGTGATGCTCCGTCTGAACCCATACGCAGCTGTCTTCGCCAAGGAGGCTGCCGGCAAG
GAGGGTGCCAAGAAGGAGGGTGCCAAGAAGGACGGCGCCAAGGAGGGTGCAAAGAAAGAGAGTGGCAAGCAGGAG
AGCGCCAAGAAGGGCCCGGCCAAGAAGAAGTAG
Transcript >Ophun1|3474
ATGACTTCGCGACCTACCGTCTCCATCATCGGCAAAGATGGTGCTCCCACGGGCAGCACGCATCCCATGCCCGCC
GTCTTCACCAGCCCCATCCGTCCCGACATCGTCCAAAAGGTGCACACCGGCATGGCGAAGAACAGGCGTCAGCCT
TATGCCGTGAGCGAAAAGGCTGGCCACCAGACCTCTGCCGAGTCTTGGGGAACGGGTCGTGCTGTCGCGCGTATC
CCTCGTGTGTCTGGTGGTGGTACCCACCGTGCTGGCCAGGCTGCCTTTGGTAACATGTGCCGTTCTGGCCGCATG
TTCGCGCCCACCAAGATCTGGCGCAAGTGGCACATTAAGATCAACCAGGGCCAGAAGCGCTACGCTACCTGCTCT
GCTGTGGCCGCCTCGGCCGTGGCACCCCTGCTGATGGCCCGTGGCCACCAGATCATGACGATCGCCGAAGTTCCC
CTTGTCGTCGACTCCGAGCTCTTTGAGGGCGCCTCGTTGGCCCGCACCGCGTCTGCCATTGCTCTTTTGAGGGCA
GTCGGCGCCGGCGCCGATTTGGACAAGGTCAAAGCCTCCAAGAAGCTCCGTGCCGGAAAGGGCAAGCTCCGTGGC
CGCCGTCACCGCCAACGTCGCGGCCCTCTTGTCGTCTACTCCCCCGAGGTCGATGGCAAGGAGCTTGTCAGGGGC
TTCCGCAACATTCCCGGCATCGAGACATGCCCCGTTACCGCCCTGAACCTCCTTCAGCTTGCTCCTGGCGGTCAT
CTTGGCCGCTTTGTCATCTGGACTTCGGCAGCCTTCAAGGCCCTCGACGAGATCTATGGTTCCACGACGGAGCCG
TCCGCCCTCAAGCGCGACTTCTTGCTGCCGTCCAACGTCGTCTGCCAAGCCGACCTGACGCGCCTGATCAACAGC
TCCGAAATCCAGAGCTCTCTCAACGCTCCCAAGGGCGACGCCATCACCCGACGGTCCGCCGTCCAAAAGAAGAAT
CCCCTGCGCAACAAGCAGGTGATGCTCCGTCTGAACCCATACGCAGCTGTCTTCGCCAAGGAGGCTGCCGGCAAG
GAGGGTGCCAAGAAGGAGGGTGCCAAGAAGGACGGCGCCAAGGAGGGTGCAAAGAAAGAGAGTGGCAAGCAGGAG
AGCGCCAAGAAGGGCCCGGCCAAGAAGAAGTAG
Gene >Ophun1|3474
ATGACTTCGCGACCTACCGTCTCCATCATCGGCAAAGATGGTGCTCCCACGGGCAGCACGCATCCCATGCCCGCC
GTCTTCACCAGCCCCATCCGTCCCGACATCGTCCAAAAGGTGCACACCGGCATGGCGAAGAACAGGCGTCAGCCT
TATGCCGTGAGCGAAAAGGCTGGCCACCAGACCTCTGCCGAGTCTTGGGGAACGGGTGAGTGAGGACGGATATAG
ATGCTGCTGAGGGCTGGGCTCATTGGGGGAATCTAGGTCGTGCTGTCGCGCGTATCCCTCGTGTGTCTGGTGGTG
GTACCCACCGTGCTGGCCAGGCTGCCTTTGGTAACATGTGCCGTTCTGGCCGCATGTTCGCGCCCACCAAGATCT
GGCGCAAGTGGCACATTAAGATCAACCAGGGCCAGAAGTACGCCGAGCCCAACGTCTTTGTCGACGACTAGATGC
TGACCCTGAAATAGGCGCTACGCTACCTGCTCTGCTGTGGCCGCCTCGGCCGTGGCACCCCTGCTGATGGCCCGT
GGCCACCAGATCATGACGATCGCCGAAGTTCCCCTTGTCGTCGACTCCGAGCTCTTTGAGGGCGCCTCGTTGGCC
CGCACCGCGTCTGCCATTGCTCTTTTGAGGGCAGTCGGCGCCGGCGCCGATTTGGACAAGGTCAAAGCCTCCAAG
AAGCTCCGTGCCGGAAAGGGCAAGCTCCGTGGCCGCCGTCACCGCCAACGTCGCGGCCCTCTTGTCGTCTACTCC
CCCGAGGTCGATGGCAAGGAGCTTGTCAGGGGCTTCCGCAACATTCCCGGCATCGAGACATGCCCCGTTACCGCC
CTGAACCTCCTTCAGCTTGCTCCTGGCGGTCATCTTGGCCGCTTTGTCATCTGGACTTCGGCAGCCTTCAAGGCC
CTCGACGAGATCTATGGTTCCACGACGGAGCCGTCCGCCCTCAAGCGCGACTTCTTGCTGCCGTCCAACGTCGTC
TGCCAAGCCGACCTGACGCGCCTGATCAACAGCTCCGAAATCCAGAGCTCTCTCAACGCTCCCAAGGGCGACGCC
ATCACCCGACGGTCCGCCGTCCAAAAGAAGAATCCCCTGCGCAACAAGCAGGTGATGCTCCGTCTGAACCCATAC
GCAGCTGTCTTCGCCAAGGAGGCTGCCGGCAAGGAGGGTGCCAAGAAGGAGGGTGCCAAGAAGGACGGCGCCAAG
GAGGGTGCAAAGAAAGAGAGTGGCAAGCAGGAGAGCGCCAAGAAGGGCCCGGCCAAGAAGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail